KEGG   Aspergillus flavus: AFLA_112810Help
Entry
AFLA_112810       CDS       T01090                                 

Definition
(RefSeq) trytophan synthase alpha subunit, putative
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
afv  Aspergillus flavus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AFLA_112810
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AFLA_112810
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AFLA_112810
Enzymes [BR:afv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AFLA_112810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 711 aa AA seqDB search
MEQIKQVFSYAKQQNRAVLGAYVTAGYPIVEETVDILLGLANGGADMIELGVPFTDPIAD
GPIIQEANAKALTNGVTISSVLNIVREARHRGLQIPVLLMGYYNPILRYGEERMLEDCKE
AGVNGFVIVDLPLEEAIRFRRLCASNGLSYVPLIAPSTSDSRMKLLCSIADSFIYVVSRM
GVTGATKKLNLNLPELLSRVHTWSGDVPSVIGFGISTREHFLSVHNIAEGCVIGSQIITT
LREAPTGQAAKHVEQYLSSITGRNHGRDSQEMLTQPLSPVPQPKAILAENVTPNSLSLID
PLDTIHSAAQSSRFGGFGGQYVPEALMGCLAELERGFEEVRQDPSFWEEYRSYYPYIGRP
SPLCFAKRLTEHVGGANIWIKREDLNHTGSHKINNALGQILLARRLNKTRIIAETGAGQH
GVATATVCAKFGMKCTVYMGAEDVRRQALNVFRMKLLGAEVVAVTSKTGSCTLRDAVNEA
LRAWVTNLEDTHYILGSVVGPHPFPTIVRTFQSVIGEETKQQMKESVGKLPNAVVACVGG
GSNASGMFYPFLHESGVQLLGVEAGGDGLDTSHHSATLSAGSKGVLHGVYTYLLQDEHGQ
VSGTHSISAGMDYPAVGPELSSWKDSGRARFIAATDAQALVGFRALAEHEGIIPALESSH
AVFGAMELAKTMKKGETDIVLNLSGRGDKDVQSVAAALPRLGPVIGWDLRF
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atggagcagattaagcaagtattttcatatgcgaagcagcagaatcgcgctgttttgggg
gcctatgttaccgcaggatatcccattgtcgaagagacagtagatattctccttggcctg
gcgaatggtggtgccgatatgatcgaactgggtgtcccattcaccgacccaattgcagat
ggtccaatcatccaggaagccaatgcgaaagctctaaccaatggcgtgacaatttcgtct
gtgttgaatatagtgcgcgaagcaaggcatcgagggctccagattcccgttctgctaatg
ggttattataacccgatactgcgttacggtgaggaacgcatgctggaagactgcaaagag
gcgggtgtcaacgggtttgtaatcgtggatcttcctcttgaggaagccattcgattcaga
agactctgcgcgagcaatgggctttcttacgttcccctcattgctccctccacctccgat
tctcgcatgaaactcctgtgcagtatagccgattcgttcatctatgttgtatcaagaatg
ggcgtgactggtgcaactaagaaactaaacttgaaccttcctgaacttctaagccgggtc
catacttggtctggagatgtaccatccgtgattggctttggtatcagtacgcgcgaacat
ttcttgtctgtacataacatcgccgaaggttgtgtgattggcagtcaaataatcaccaca
ttacgcgaggcacctactggccaagcagctaagcatgtcgaacagtatctatcgagtatc
accgggcgaaatcatggaagagattcacaggagatgctgacccagccactttcgcctgtt
ccgcagccaaaagccatcctcgccgaaaatgttactcccaacagcctgtcactgatcgat
ccactcgacacaattcactccgctgcacaatcgtcgcgctttggtgggttcggcggtcaa
tacgttcctgaagccctgatgggttgtctcgccgagctagagagaggcttcgaggaagta
cgacaggatcctagtttttgggaagaataccgttcctactacccttatatcggtagaccc
agccctctctgttttgcaaaacggcttactgaacatgtcggcggtgcgaatatctggatt
aaacgagaagatctcaaccatactggaagccacaagatcaataatgccttgggtcagatc
cttctggctcgacggctgaataaaactcgcattattgctgaaactggtgctggccaacat
ggagtcgcaactgcaactgtgtgtgcgaagtttggaatgaagtgcaccgtttatatgggt
gctgaggatgtccgtcggcaagccttgaatgtgttccgtatgaagcttcttggtgccgag
gtagtggctgttaccagtaaaacgggaagctgtactctacgtgatgccgttaatgaagct
ctacgggcatgggttactaacctcgaggatacacattatatccttggttctgttgttgga
ccacatcctttcccaacaattgtacgcacctttcaatctgtgattggcgaagagaccaaa
caacaaatgaaagaatccgttggcaagcttcccaatgctgttgttgcatgcgttggaggt
ggcagcaatgcatctggcatgttctatccctttttacatgagtcaggcgtccagctttta
ggcgtggaagctggtggagatggtctcgatacgtctcatcattcagcaacgctttctgcg
ggcagtaagggtgtgcttcatggagtctacacctatcttttgcaggatgaacatggtcag
gtttctggaacgcactctatctctgctggtatggactatccagccgtgggaccagagttg
agctcttggaaagacagcgggcgggctcggtttattgctgccacagacgcccaagctcta
gtcggcttccgggcattggcagagcatgaaggtattatcccggctttggagtcctcgcat
gccgtatttggcgccatggaactagccaaaacgatgaagaaaggggaaacggacattgtc
ctgaatcttagtggcagaggcgacaaggatgttcaaagtgttgctgctgctctgccacgg
ttggggcctgttatcggatgggacttgagattttga

DBGET integrated database retrieval system