KEGG   Aspergillus flavus: AFLA_113050Help
Entry
AFLA_113050       CDS       T01090                                 

Definition
asparagine synthetase Asn2, putative
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
afv  Aspergillus flavus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AFLA_113050
Enzymes [BR:afv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     AFLA_113050
Peptidases [BR:afv01002]
 Cysteine Peptidases
  Family C44
   AFLA_113050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 573 aa AA seqDB search
MCGIFACYNHPDVQKFKPTALRMAKAVRHRGPDWSGNYIADKTILAHERLCIVGVDSGAQ
PLVNDDGSLALAVNGEIYNHRIIRKNLKNQYDFKTHSDCEVVIPLYMEHGLDAPKHLDGM
FSWVLYDRKQDRVVAARDPIGVTSFYIGWSSETPGAIYFASELKSLHPVCDKIEAFPPGH
IFDSKTGSMTRYFEPKWWDPTNVPTTPVDLKVLRHTLEKSVRKRLMAEVPYGVLLSGGLD
SSLVASIAQRETLRMQEAAKVAIQNQTGSSDLVGIDDSNELSTVTTFQQLHSFSIGLPGA
PDTEAALEVAKYLGTKHHAFTFTVEDGINALSDVIYHLETYDVTTIRASTPMYLLSRKIK
AMGVKMVLSGEGSDEIFGGYLYFHAAPNKEEFHNETVRRVKALHLADCLRANKSTSAWGL
EARVPFLDKNFLETAMGVDPQDKMITKERIEKYILRKAFDTTDEPDVEPYLPEKILWRQK
EQFSDGVGYSWIDGLKDHAELHVTDEMMKNPKPEWGNDIPDTKEAYWYRMMFDEHFPPSC
ASTVERWVPTWSKQTDPSGRAIATHNAKYDHVE
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatcttcgcgtgttataaccaccctgatgtgcaaaaatttaagcctacggct
ttgcgcatggccaaggccgtgcgccatcgtggacccgattggagcggaaactacatcgct
gataagactatccttgcacacgagcgtctgtgtatcgtcggtgtcgactccggtgctcag
ccccttgtgaacgatgacggttccctcgccctggccgtcaacggagagatctataaccac
cgcatcatcagaaagaaccttaagaaccaatatgacttcaagacacattcggattgcgaa
gttgttattccgttgtacatggaacatggtcttgatgcccctaagcaccttgacggcatg
ttctcttgggttctttatgacagaaagcaagaccgtgttgttgcggcacgcgatcccatt
ggtgtcactagcttctacatcggctggtcttcggagacccctggagctatctacttcgct
tcggagctgaagtccctgcacccagtttgcgataagatcgaggctttccctcctggccac
attttcgactccaagaccggctctatgactcgttatttcgaacctaagtggtgggacccc
actaacgtccccacgactcctgtcgaccttaaggttctccgtcacaccttggagaagtct
gttcggaagcgtctgatggctgaagttccttatggtgttctgctgtccggtggtctggac
tccagcttggtcgcctccattgctcagcgtgagactttgcgcatgcaggaggctgccaag
gtagccatccagaaccagactggctcatccgatctggttggcattgacgacagcaacgag
ctctctaccgtcaccacattccaacagctgcattccttctccatcggtcttcctggtgct
cccgatactgaggctgcccttgaggtggccaagtaccttggaaccaagcaccacgctttc
accttcaccgttgaggatggtatcaatgctctttccgatgtcatctaccacctggagact
tatgatgttactaccatccgtgcatctacccccatgtatctcctcagccgcaagatcaag
gcgatgggtgtaaagatggttctgagtggtgagggaagtgacgagatcttcggtggctac
ctctacttccacgctgcccctaacaaggaggaattccacaatgagactgtgagacgagtc
aaggccctgcacctggcagattgccttagagcgaacaagtcgacttccgcttggggtctg
gaagcccgtgtgcctttcttggataagaacttccttgagactgctatgggtgttgatcct
caggataagatgatcactaaggagcgcattgaaaagtacatcctgcgtaaagcattcgac
accaccgatgagcccgatgtcgagccataccttccggagaagatcctctggcgccagaag
gaacagtttagcgacggcgtcggctacagctggatcgacggtctgaaggatcatgctgaa
cttcatgtcaccgatgaaatgatgaagaaccccaagcccgagtggggcaacgatatccct
gataccaaggaagcttactggtaccgtatgatgttcgatgagcacttcccaccttcctgc
gcatctaccgttgagcgttgggtgccaacatggtcgaaacagaccgaccctagtggaaga
gctattgcgactcacaacgccaagtacgatcatgttgagtaa

DBGET integrated database retrieval system