KEGG   Aspergillus flavus: AFLA_114790Help
Entry
AFLA_114790       CDS       T01090                                 

Definition
myo-inositol-1(or 4)-monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
afv  Aspergillus flavus
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AFLA_114790
Enzymes [BR:afv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     AFLA_114790
Transfer RNA biogenesis [BR:afv03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    AFLA_114790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 352 aa AA seqDB search
MEPTHPYVKELEIACLTVQRATLLTKKVLDAVDKGALDKSDSSPVTIADFAAQALIIAAI
HRAFPDDDIVGEEDSKALRGNEALLERTWELVSSIHLDDETSEALLYSPKNKEEMLDLID
LGARGTCSRENRSWVLDPVDGTATFINGQQYAVCLALVENGVQKLGVLGSPNLNLETGRM
HEDIVDRDGYGYQLFAVAGHGAFMRKMGTGTLLPATRINAKPQITDPKDLDFVDCVAATS
SDIVAHERLASHLGAPWPHTTDLWAAQLRYVAIAVGGCNTLIKIPRNASYRSKMWDHAGG
MLIVQELGCIVSDLAGNPVDCGLGRTLASCYGMIVAPASIHGQLVEAVKQIM
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggagccaacgcatccttacgtgaaggagctcgaaattgcttgtctaacggtgcaaaga
gctactcttttgacgaagaaggtgctcgacgcggtcgacaaaggggctttggacaaaagt
gactcgagccccgtgaccattgctgactttgctgcccaagcattgatcattgcggcaatt
catcgggccttcccggacgatgacattgtgggagaagaagactccaaggctcttcggggg
aatgaggccttgcttgagcgtacgtgggaactcgtctcctccattcatcttgacgatgag
acgagcgaggcgctcctttactccccgaagaacaaggaggagatgctcgacttaattgac
ttgggcgcccgcggcacctgtagccgagagaaccgctcgtgggttttggacccggtggat
ggcaccgcaacgttcatcaatggccagcagtatgcggtttgcttggcactcgtagagaac
ggggtccagaagctcggcgtcttggggagtccgaatctcaacctggaaacgggccgcatg
cacgaggatatagtggaccgagatgggtatggatatcaactcttcgccgttgccggtcac
ggtgcattcatgcggaagatggggaccgggaccctcctgcctgctactcgcattaatgcc
aagcctcagatcaccgaccctaaggatcttgacttcgtggattgcgtcgcggccacttcc
tcagacattgtggcgcatgaacgccttgcgtcccacctgggtgcgccgtggccacacacg
acggatctctgggcggcccaactgcgatatgtcgccattgcggtcggtggctgcaatacc
ttgatcaagatcccacgcaacgcgtcctatcgatcaaagatgtgggatcatgcagggggc
atgttgatcgtgcaggagctaggctgtatcgtcagtgaccttgccggcaatccggtggac
tgcggtctgggcaggaccctggccagttgttacggaatgatagtggcgccggcctccatc
catggacagctggttgaagccgtcaagcagattatgtag

DBGET integrated database retrieval system