KEGG   Aspergillus flavus: AFLA_115010Help
Entry
AFLA_115010       CDS       T01090                                 

Definition
TFIIH and nucleotide excision repair factor 3 complexes subunit
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
afv  Aspergillus flavus
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:afv03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:afv03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 480 aa AA seqDB search
MAMAVAPSRPFDYLESLPGTTFYKLYQQPSTALAIFRRMLPDLAKCFVMALLYLKDPLPA
TDLEAWVKAESLKERDNALSILGRLHILSNTVITDNVRAYKVTDPFASSLRQALTGAEKT
QSFGVLWHISDGAAVSIAELDEYARRQWEGVLGYMVGTSGLGIQRDANLSKGVKQLLQAG
HLVEIRDRRVEITQDGFAFVLQDVSTQVWHILMLYVESADAIGMSSVEVLSFVFLLSSLE
LGKAYDKKHLTSNQLRTLTDLADFGIVYQDSPDASHFYPTRLATTLTSDSSALSNPISGS
LSGPSGTGSNKAGSGFIIVETNYRLYAYTSSPLQISLIALFTTLKYRFPNLITGKITRQS
VRRAIEMGITADQIISYLATHAHPQMRKHNVSRSTSNQAGIPPSVLPPTVTDQIRLWQLE
RDRVKATPGFLFKDFVSLAEYEAPCRYAEEIGVLVWKSDRKRMFFVTRHEQVAAFLRSRK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggccatggctgtcgctccctcccgtccatttgattatctggaaagcctgcctggaacg
actttctacaagctctaccagcagccatctaccgccctcgccatcttcaggcgcatgtta
cctgacctagcaaaatgtttcgtcatggcgcttctatatcttaaagaccctctcccagca
acagatctggaggcctgggtcaaggcagaaagcttgaaggagcgagataatgcattgtca
atactgggtcgactccatattctatccaacaccgtgatcacagataacgttcgtgcgtac
aaagtcaccgatccgtttgcctcatcgctccgtcaggctctgacgggcgctgaaaagacg
cagtcctttggtgtactctggcatatatcagatggagcagccgtttccatagctgaactg
gacgagtacgcccggcgtcagtgggagggggtattgggatacatggtcggaaccagcgga
cttggtattcagcgcgatgcaaacctgagcaaaggcgtgaagcaacttttgcaggctggg
catcttgtcgaaatccgggatcgtcgcgtggagatcacacaagatggattcgcttttgtt
ctacaggatgtcagcacccaagtttggcacatccttatgctctatgttgaaagcgcggac
gcaatcggaatgagcagtgtggaggtcctctcgttcgttttcttgctgagcagcttggag
cttggaaaagcatacgataagaagcacctgacatcaaaccaactccgtactctgacggac
ctggcggattttggcattgtctaccaagattccccggatgccagtcatttctaccccact
cgcctcgccactactcttacctccgactccagcgctttgagcaaccccatttcaggttcc
ctctccggtccctctggcacaggctcaaacaaggcgggatctggattcatcatcgtcgaa
acaaactaccgactgtatgcatatacctcttcgccgttgcagatctctcttattgcactt
ttcactacacttaaataccgctttcccaacctgatcaccggcaaaattacccgccagtcg
gtgcgccgcgccatagagatgggtatcactgccgaccaaattatctcgtatctggctacc
cacgctcaccctcagatgcgcaaacataatgtctcccgatctacgtctaatcaggccgga
ataccgccatccgttctgcccccgactgtcactgatcagattcggctttggcaactggaa
cgagatcgcgtcaaagcaacccctggctttttgttcaaggacttcgttagcttggcagaa
tatgaggctccatgtcggtacgctgaagagatcggggttctcgtctggaaatcagatcga
aagcggatgttctttgtaacgaggcatgagcaagttgcagctttcttgaggagtaggaaa
tag

DBGET integrated database retrieval system