KEGG   Aspergillus flavus: AFLA_117790Help
Entry
AFLA_117790       CDS       T01090                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3, putative
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
afv  Aspergillus flavus
Brite
Enzymes [BR:afv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AFLA_117790
Peptidases [BR:afv01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   AFLA_117790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 250 aa AA seqDB search
MSTTLPTGAKIINGVKTFIPLENNPEVHTHLATTLSIQSLTFHDIFTLSPPPQDLPHPIN
ALIFLAAAPIYTRARSTLQSTLPKYTTTNETDPIWIPQTIGHACGLMAFLHCVLNLDDGR
HLACGSELAKLREELVSLAPGDRARVVYEALFLEEAHMDAARGGSSGVPGPEEDNGFHFV
GFVKGGDGRVWELNGGMPGPLERGVLGDGEDLVSEAGLRLTVGDFMEAAKEVEGGGYGGL
GISLVGLVGV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccacacttcccaccggcgccaaaatcatcaacggggtcaagaccttcattccc
ctcgaaaacaaccccgaagtccacacccacctcgctaccaccctctcaatccaatccctc
accttccacgacatcttcaccctctccccgcctccccaagacctaccccatcccatcaac
gccctaatcttcctcgccgcagcacccatctacacccgcgcccgctcaaccctccaatcc
acactccccaaatacacaaccaccaatgaaacagacccaatctggatcccccagacaatc
ggccacgcttgcggccttatggcgtttctgcactgtgtgctgaatctcgatgatgggagg
catctagcttgtgggtctgagttggcgaagttacgggaggaactggtctcgttggcgccg
ggggatcgtgctagggtggtttatgaggcattgtttctggaggaggcgcatatggatgcg
gcgcggggaggtagttcgggggtgccagggccggaggaggataacgggtttcattttgtg
gggtttgtgaagggcggggacgggagggtttgggagttgaatgggggtatgccggggcct
ttggagaggggagttcttggggatggtgaggatttggtttcggaggctgggttgaggttg
acggttggggattttatggaggctgcgaaggaggttgaggggggtgggtatgggggtttg
gggatttctttggttgggttggttggtgtgtag

DBGET integrated database retrieval system