KEGG   Aspergillus flavus: AFLA_118010Help
Entry
AFLA_118010       CDS       T01090                                 

Definition
cap binding protein
Orthology
K03259  
translation initiation factor 4E
Organism
afv  Aspergillus flavus
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:afv03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 247 aa AA seqDB search
MAAVAENGPVPVNDENTAPAVAAPEQKEETEKTNGDNITVFHDPENFNVKHPLMHEWTLW
FTKPPSGKGDNWNDLLKEVVTFNSVEEFWGIYNNITPTSELGLKADYHLFKKGIRREWED
PQNKHGGKWSYSFKDKRSVPIDDLWLHAQLAAIGETLENDGDSEVMGVVVNVRKGFYRVG
LWTRTVGKSIPGDKSSRTPAQGKDVLESIGRRFKEVLRLNEADVVEFSGHTDSAHSGSTR
AKAKYTV
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgttgctgaaaacggtcccgtaccggtgaacgacgagaacaccgcgcccgcc
gttgccgcccccgagcagaaggaggagaccgagaagacaaatggcgacaacatcacagtg
ttccacgaccctgagaacttcaacgtgaagcatcctctcatgcacgagtggaccctgtgg
ttcacaaagcctcctagcggcaagggcgataactggaacgaccttttgaaggaagttgtc
acatttaactcggttgaggaattctggggaatctacaacaacatcacaccgacctctgag
ttgggcctcaaagcagactaccatcttttcaaaaagggtatccggcgtgagtgggaagac
cctcagaacaagcacggcggcaagtggtcgtattcgttcaaagacaagcgttctgtacct
atcgacgatctgtggctgcacgcccaactggcagccattggtgagactctcgaaaatgat
ggcgacagcgaggttatgggagtcgttgtgaatgtgcgtaagggtttctaccgtgtcggt
ctgtggacacggactgtgggcaagagcattccgggagacaagagttcccgcacacctgct
cagggcaaggacgttctcgaatccatcggccgccggttcaaggaagtcttgcgtttgaac
gaggcggacgttgtggagttctctggacacacagacagtgcacacagcggtagcacgagg
gcgaaggccaagtacactgtttga

DBGET integrated database retrieval system