KEGG   Aspergillus flavus: AFLA_118010Help
Entry
AFLA_118010       CDS       T01090                                 

Definition
cap binding protein
Orthology
K03259  
translation initiation factor 4E
Organism
afv  Aspergillus flavus
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:afv00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AFLA_118010
Translation factors [BR:afv03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    AFLA_118010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 247 aa AA seqDB search
MAAVAENGPVPVNDENTAPAVAAPEQKEETEKTNGDNITVFHDPENFNVKHPLMHEWTLW
FTKPPSGKGDNWNDLLKEVVTFNSVEEFWGIYNNITPTSELGLKADYHLFKKGIRREWED
PQNKHGGKWSYSFKDKRSVPIDDLWLHAQLAAIGETLENDGDSEVMGVVVNVRKGFYRVG
LWTRTVGKSIPGDKSSRTPAQGKDVLESIGRRFKEVLRLNEADVVEFSGHTDSAHSGSTR
AKAKYTV
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgttgctgaaaacggtcccgtaccggtgaacgacgagaacaccgcgcccgcc
gttgccgcccccgagcagaaggaggagaccgagaagacaaatggcgacaacatcacagtg
ttccacgaccctgagaacttcaacgtgaagcatcctctcatgcacgagtggaccctgtgg
ttcacaaagcctcctagcggcaagggcgataactggaacgaccttttgaaggaagttgtc
acatttaactcggttgaggaattctggggaatctacaacaacatcacaccgacctctgag
ttgggcctcaaagcagactaccatcttttcaaaaagggtatccggcgtgagtgggaagac
cctcagaacaagcacggcggcaagtggtcgtattcgttcaaagacaagcgttctgtacct
atcgacgatctgtggctgcacgcccaactggcagccattggtgagactctcgaaaatgat
ggcgacagcgaggttatgggagtcgttgtgaatgtgcgtaagggtttctaccgtgtcggt
ctgtggacacggactgtgggcaagagcattccgggagacaagagttcccgcacacctgct
cagggcaaggacgttctcgaatccatcggccgccggttcaaggaagtcttgcgtttgaac
gaggcggacgttgtggagttctctggacacacagacagtgcacacagcggtagcacgagg
gcgaaggccaagtacactgtttga

DBGET integrated database retrieval system