KEGG   Aspergillus flavus: AFLA_119290Help
Entry
AFLA_119290       CDS       T01090                                 

Definition
(RefSeq) phosphofructokinase, putative
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
afv  Aspergillus flavus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AFLA_119290
   01230 Biosynthesis of amino acids
    AFLA_119290
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFLA_119290
   00030 Pentose phosphate pathway
    AFLA_119290
   00051 Fructose and mannose metabolism
    AFLA_119290
   00052 Galactose metabolism
    AFLA_119290
  Energy metabolism
   00680 Methane metabolism
    AFLA_119290
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AFLA_119290
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AFLA_119290
Protein phosphatases and associated proteins [BR:afv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AFLA_119290
Messenger RNA biogenesis [BR:afv03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AFLA_119290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 643 aa AA seqDB search
MTNTILDTYSSRRKPRRIGILTSGGDAPGMNGAIRAVVRTAIQNGCEAWAIHEGYEGLIQ
GGAMMHPLYWEDVRGFLSRGGTLIGSVRCDRFREREGRLQAARNMVLFGIDALVVCGGDG
SLTGADLFRSEWPELLNELVSTGVLTVAQVAPHQNLNIVGLLGSIDNDFSGTDATIGCYS
ALTRICEAVDAVFDTASSHRRGFVVEVMGRHCGWLALMAAIATGADWLFIPERPPRDGWE
DDMCSIITKNRNRGKRRTIVILAEGAQDSNLDRISSSAVKDVLSKRLGLDTRVTVLGHIQ
RGGSPCAYDRWLSTLQGIHAVKAVLSMTPESPSPVVIIQENRIRASSLAETVALTKEANA
SMHAKEFEKAATLRDPEFMEYHSAYRHLNTSDHPKMVLPEDKRMRVAIIHVGAPAAGMNP
ATRAVVAYCLTRGHTPIAIHNGFPGLCRHHDDTPGSVREMHWLESGDWINDGGSDIGTNA
GLPLDDIETTAQCFERYKFDALFVIGGFEAFTAVSQLRKARKQYLAFRIPLVLLPASMSN
NVPGTEYSLGSDTSLNTLVYFCDVVRQSASSSGHSVFVVEAQGAEYQATAAALAAGAMTV
YTPERGITLQSLSNDIEHPPSTVQPRLQISSNMRPRIALMRRA
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacactatattagatacttactcttcaagacgcaaaccccgccgcattggcatc
ctgacatcaggaggggatgccccgggaatgaatggagcgatccgtgcagtcgtccgcaca
gcaatacagaacggctgtgaagcatgggcaatccacgaaggctacgagggactcatccag
ggcggtgcaatgatgcatcctttatattgggaagacgttcgaggtttcctatcccgtgga
gggacactcattggatccgtacgctgtgatcgttttcgcgaacgagaaggtcgtcttcag
gcggcaaggaatatggtgcttttcggcatcgacgccttagttgtctgtggtggggatgga
agcttgaccggggcagacctcttccgatccgaatggccagagctgctcaatgagctggtc
tcaacaggtgttttgaccgtggcgcaagtcgcacctcatcagaacctgaatattgtcgga
ctactcggctctatcgacaatgacttttccggcacagatgccaccattggatgctattct
gcattaacacggatctgcgaagcagtcgatgcagtgtttgacacggcttcttctcatcgc
cgagggtttgttgttgaagtcatgggccggcactgtggctggctagcgttgatggctgct
atcgcaactggggcggattggttgtttatcccggagaggcctccgcgcgacggctgggag
gatgatatgtgttcaatcatcaccaagaaccgcaaccgtggcaaacgtcgcactatcgtt
attctggcagaaggtgcccaggacagcaacttggatcgcatttcgtcatctgccgtgaaa
gatgttctgagcaagcgcttagggctcgatacccgcgtcactgttctaggtcatatccaa
cgaggcggatccccatgtgcatacgaccgctggctatcaaccttacaaggcatccacgcc
gtcaaagcggtgctgtctatgactcctgagtcgccctctccggtggtgattatccaggaa
aatagaatcagagcatcgtctctggctgaaactgttgccttaacgaaggaggccaatgcc
agtatgcacgccaaagaattcgagaaagcagcaacacttcgggatcccgaattcatggaa
tatcatagcgcctaccgacacctgaacacgagtgaccatcccaagatggtcttacccgaa
gataagcgcatgcgggttgctatcattcacgttggcgccccagctgcaggcatgaatcca
gccacacgcgcagtagtcgcctattgcttaaccagaggacataccccgatcgccatccac
aacggtttccctggtctctgccgacaccatgacgatacccctggctcggttcgtgaaatg
cattggttggaatctggtgactggatcaacgacggcgggtctgacattggtaccaatgcg
ggactaccattagacgatatcgaaacgacagctcaatgcttcgagcgatataagtttgat
gcacttttcgttattggaggcttcgaagcgttcacagccgtcagtcaactgcgcaaggcg
cgtaagcaatatcttgccttccggattccgctcgtccttctcccagcaagtatgtcaaat
aatgtccccggcacggaatactcccttggaagcgacaccagtcttaatacccttgtttat
ttctgcgatgttgttcggcaatctgcgtcctcctccgggcatagcgttttcgtcgtggaa
gcgcaaggagccgagtaccaggcgacagctgctgcgctggccgcaggagcaatgaccgtg
tatacgcctgaacgaggaataactctacaaagcctctccaatgatattgaacatccacca
tctacagtacaaccgagattgcaaatatcatcaaacatgaggccaagaatcgctttgatg
cgcagggcgtag

DBGET integrated database retrieval system