KEGG   Aspergillus flavus: AFLA_119670Help
Entry
AFLA_119670       CDS       T01090                                 

Definition
glycogen branching enzyme GbeA, putative
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
afv  Aspergillus flavus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AFLA_119670
Enzymes [BR:afv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     AFLA_119670
Exosome [BR:afv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AFLA_119670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 265 aa AA seqDB search
MAVPDMYIKLLKEKKDDEWDIGNLSFTLTNRRHGEKTIAYAESHDQALVGDKTLMMWLCD
KEMYTHMSVLTEFTPIIERGMALHKLIRLVTHGLGGEGYLNFEGNEFGHPEWLDFPRDGN
NNSFWYARRQLNLTEDHLLRYKFLNDFDRAMQLTEEKYGWLHSPQAYVSLKNETDKVLVF
ERAGLLWIFNFHPTNSFTDYRVGVEQSGTYRIVLDTDDPAFGGLNRNLKETRFFTTDLSW
NGRSNFLQVYIPTRTALVLALEETL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcccagacatgtatatcaagctcttgaaagagaagaaggacgacgagtgggac
ataggaaacctatccttcacgctgacgaacagacgccatggcgagaagacgattgcctac
gcagaaagccacgatcaagcgcttgttggcgataaaaccctcatgatgtggctatgcgac
aaagaaatgtacacacacatgtccgtgctaacagaattcacacccatcatcgaacgaggc
atggccttgcataagttgatccgattagtcacacatggtctcggaggtgaaggctacctc
aacttcgaaggcaacgagttcggacacccggaatggcttgacttcccccgagatggaaac
aataactccttctggtatgcacgacgtcagctaaatctgaccgaagaccatcttctgcgg
tataaattcctcaatgatttcgaccgtgcgatgcaattgacagaagaaaaatacggatgg
ctccattcgccacaggcatatgttagcctaaagaacgaaaccgacaaggtcctcgtcttt
gagcgggctggtcttctctggattttcaacttccacccaaccaatagcttcaccgactac
cgtgttggggtcgagcaatcaggcacgtaccgtatcgtcctcgacaccgatgacccagca
ttcggtggtctgaaccgcaatcttaaggagacacggttttttaccaccgatttatcgtgg
aatggccggagcaacttcctccaagtctacatccctaccaggaccgcactagtcctggcc
ttagaggaaacgctgtag

DBGET integrated database retrieval system