KEGG   Aspergillus flavus: AFLA_121790Help
Entry
AFLA_121790       CDS       T01090                                 

Definition
7-dehydrocholesterol reductase, putative
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
afv  Aspergillus flavus
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    AFLA_121790
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     AFLA_121790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 206 aa AA seqDB search
MVAVVTLRVFVVVDFFINELWFFHTLDGMYESFGFYNIYGFSAMMPVLWSLQTQYLAKRP
EELSTIALTSVILLFLAGWLIRFSADYQKMKFRQTGGECRIWGNKANKIRASYQTADGKL
CHSLLLCSGWWGLARHANYTGSAMYTLALCAACGRGGIFPYTEAIIVGGIVIHRCYRDEG
KCAAKYGKDWDEYCRQVQWRMIPGIY
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggtagtcactttacgcgtgttcgttgtggtggattttttcatcaatgagtta
tggtttttccacactctggacggtatgtacgagtccttcggcttctataacatctacggg
ttctcggctatgatgcccgtgctttggtcgttacaaacacagtacctggccaaacgtccc
gaggaactctctacgatagcactcacgagtgtcatattactctttcttgctggctggttg
atccgcttctctgcggactatcagaaaatgaagttccgtcaaacaggcggagaatgtcga
atttggggcaacaaagccaacaagattagagcgtcgtaccaaactgcagatgggaaacta
tgtcactccttgctcctatgctctggatggtgggggctggctcgccatgcaaactataca
ggcagcgcgatgtacactctggctctctgtgctgcttgtggccgtggcggaatcttccct
tacactgaggcgattatagttggagggatagtgattcatcgatgttatcgcgacgaagga
aagtgtgcagcgaaatatggaaaagactgggatgagtactgccgtcaggtgcagtggagg
atgatccctggtatttactaa

DBGET integrated database retrieval system