KEGG   Aspergillus flavus: AFLA_122400Help
Entry
AFLA_122400       CDS       T01090                                 

Definition
glucan 1,4-alpha-glucosidase, putative
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
afv  Aspergillus flavus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:afv00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 612 aa AA seqDB search
MVSFSSCLRALALGSSVLAVQPVLRQATGLDTWLSTEANFSRQAILNNIGADGQSAQGAS
PGVVIASPSKSDPDYFYTWTRDSGLVMKTLVDLFRGGDADLLPIIEEFISSQARIQGISN
PSGALSSGGLGEPKFNVDETAFTGAWGRPQRDGPALRATAMISFGEWLVENGHTSIATDL
VWPVVRNDLSYVAQYWSQSGFDLWEEVQGTSFFTVAVSHRALVEGSTFAKTVGSSCPYCD
SQAPQVRCYLQSFWTGSYIQANFGGGRSGKDINTVLGSIHTFDPQATCDDATFQPCSARA
LANHKVVTDSFRSIYAINSGRAENQAVAVGRYPEDSYYNGNPWFLTTLAAAEQLYDALYQ
WDKIGSLAITDVSLPFFKALYSSAATGTYASSTTVYKDIVSAVKAYADGYVQIVQTYAAS
TGSMAEQYTKTDGSQTSARDLTWSYAALLTANNRRNAVVPAPWGETAATSIPSACSTTSA
SGTYSSVVITSWPTISGYPGAPDSPCQVPTTVSVTFAVKATTVYGESIKIVGSISQLGSW
NPSSATALNADSYTTDNPLWTGTINLPAGQSFEYKFIRVQNGAVTWESDPNRKYTVPSTC
GVKSAVQSDVWR
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctttctcctcttgtctccgggccttagccctcggatcctcagttctcgcggtc
caacctgtccttagacaggcgactggtctagatacctggctgagcacagaagcaaatttt
tcccgccaggcaatcttgaataatatcggcgcagatggccagtcggcgcagggcgcaagt
ccaggggtggtgattgccagccctagcaaaagtgacccagattatttctatacctggacc
cgtgactcgggtctcgtcatgaaaaccctggtcgatctgttcagaggcggagatgccgat
cttctccctatcatcgaggagttcattagctcccaggctcggatccaaggcatctcaaac
ccttctggtgctctttccagtgggggtctgggcgagcctaagttcaatgtcgacgagaca
gcatttaccggcgcatggggtcggccgcagcgtgacggaccagctttgcgcgcgaccgct
atgatctcgtttggagaatggctagttgaaaatggtcatacaagcatagcgacggacctg
gtatggcctgttgttaggaatgatctatcctatgtggctcagtattggagccaatccggg
ttcgatctctgggaggaagtccaaggcacatcattctttactgttgcagtttctcatcgc
gctttggtagaaggtagcaccttcgcaaagactgtcggttcctcgtgcccctattgtgac
tcgcaagcgccccaagtccgatgttatttacaatccttctggaccgggagttacatccag
gccaatttcggtggcgggcgatcgggcaaagacatcaacactgtcctgggtagtatccac
acgttcgatcctcaagcgacgtgtgatgatgctaccttccagccctgttcggcgcgagcc
ttggccaaccataaggtagtaacggactcgttccgatcaatctatgccatcaactccggt
cgtgctgagaatcaagctgttgctgttggtcgctaccccgaagacagctattacaacggg
aatccttggttcctgaccaccctggccgccgcagagcagttgtatgacgcgttgtaccag
tgggataaaattggatcattggccatcacggacgtttctttgccattcttcaaagctctt
tacagttctgccgcgacagggacctacgcatcgtccacgacggtgtataaggatatcgtc
tcagccgtcaaggcctatgcagacggatacgtgcagatcgtccaaacctacgctgcatcc
accggctccatggccgagcaatataccaagacggacgggagtcagacctccgcccgggat
cttacctggtcgtacgctgcacttctcacggccaacaaccgacgaaacgcggtcgttcct
gcaccatggggcgagaccgctgccaccagcattccgtcagcttgctctacgacttccgcc
tcgggcacctacagcagcgtggttatcacatcctggccgaccattagcggatacccaggc
gcgccagacagcccctgccaggtgccgacgactgtgtcggtgaccttcgcggtgaaagct
actacggtctacggtgagtctatcaagatcgtcgggtcgatctctcagctcgggagctgg
aatcctagcagcgcgaccgcattgaacgcggacagctacactactgacaaccccttgtgg
acgggaacaataaacttgcctgctggacagtcgttcgagtataagtttattcgcgttcag
aacggggcggttacgtgggagagtgaccccaaccggaaatataccgttccttcgacttgc
ggggtgaaaagtgctgtgcagagcgatgtttggcggtga

DBGET integrated database retrieval system