KEGG   Aspergillus flavus: AFLA_125700Help
Entry
AFLA_125700       CDS       T01090                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
afv  Aspergillus flavus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AFLA_125700
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AFLA_125700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 347 aa AA seqDB search
MAAKPQICVIGSLNIDFVTYARRCPGPGETLTGSSLSIDAGGKGANQAVACARAAFTSRT
QQDVDVRMIGAVGANDPYYPTLLQPALEKSGVDTTGIEQRSDCQTGSATIIVEEGEQGEN
RIVVVPGANHDGMNDVDKLLSVVQTQCPAPPQVVVLQGEIPRSTVIGLMQHYNKSENPTN
VVLNIAPVYPDGIPLAALSGTAVLIMNETETIQMAESIPDFPVGSQTEADLQPELLAPLF
HQVAKIPIVLITLGAKGVFFSTATGRNGSVRGVRVKNVVDTTAAGDTFVGYFSAEFARYA
ATGQPLEDFDALIEPAVQQANQAAAMCVQRKGAIESIPFAYEITDRQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaaaaccacagatctgcgtcatcgggtccctcaacatcgacttcgtcacatat
gcccgccgctgtcccgggcctggcgaaacgctaacaggttcctccctgtccatcgatgca
ggcggcaaaggcgccaaccaagcggttgcatgcgcacgagcagcttttacctccagaacc
cagcaagatgtggatgtgcgtatgattggtgcagtcggtgcgaatgatccatattatccg
acgttattacagccagcattagaaaagtcaggcgtggataccacgggaatcgagcaaaga
tcagactgccaaacaggctcggcgactatcatcgtggaggaaggcgagcaaggggagaac
cgcattgtcgtggtaccgggagccaaccatgatggaatgaatgatgtcgataagctcctt
tccgttgtccagacacagtgtcctgctcccccgcaggtcgtggttctgcagggagagatt
ccgaggtcaactgtgattggtctgatgcagcattataataagagcgagaatccgacgaat
gtcgtcttgaatattgcacccgtgtatccggatggtattcccctggctgcattgtccggc
acagctgtcttgatcatgaatgaaacggagactatccagatggcggaatcaattcctgat
ttcccggtgggatctcaaaccgaagccgatctgcaaccagagctgttggctccactgttc
caccaggtggctaagattcccattgttttgatcacgctcggtgcgaagggggtgttcttc
tcaacggccaccggtcggaacggctctgttcgcggcgtgcgtgttaagaatgtggtggac
accaccgccgctggagatacctttgtgggctacttttcggctgaatttgcgaggtacgct
gccacgggacagcctctcgaggactttgacgctttgatcgagcctgcggtacagcaggcg
aatcaggcagccgccatgtgtgtgcagagaaagggcgccattgaaagtatcccatttgca
tatgagatcacagatcgccaatga

DBGET integrated database retrieval system