KEGG   Aspergillus flavus: AFLA_126790Help
Entry
AFLA_126790       CDS       T01090                                 

Definition
threonine synthase Thr4, putative
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
afv  Aspergillus flavus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AFLA_126790
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AFLA_126790
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AFLA_126790
Enzymes [BR:afv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AFLA_126790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 172 aa AA seqDB search
MTKTGSVDGDQYLKKRAGEEVLAWYQSLKATGGFGPVDKDLLENGRSTFDSDRVSNSETV
ETIKSCYQETKYVLDPHSAVAVTVAKRSLAKNGSNVHHISLSTAHPAKFSEVVESALKGE
AGFNFDEQVLPDEFKAFAQKETRVTTVENSWEKVREIVKRQAEEDIKAESSA
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacgggtagtgtggacggcgatcagtacctcaagaagagggccggtgaagag
gttttggcctggtaccaatcattgaaggcaactggcggcttcgggcctgtagataaggac
ctgttggaaaacggacggtcgactttcgacagcgaccgtgtgagcaactcagagactgtc
gagactatcaagtcttgctaccaggaaaccaaatacgttcttgatccccattcggctgtt
gcagttaccgtcgcgaagagatcgcttgctaagaatggctcgaacgtccaccacatctcg
ctctccactgctcaccccgccaaattctctgaggtcgtcgaatcagctctcaagggcgag
gccggcttcaacttcgatgagcaggtgcttcctgacgagttcaaggctttcgcgcaaaag
gagaccagggtcaccacggttgagaattcgtgggagaaggtccgggagatcgtgaaacgc
caagctgaagaggacatcaaggctgaaagcagcgcttaa

DBGET integrated database retrieval system