KEGG   Aspergillus flavus: AFLA_127500Help
Entry
AFLA_127500       CDS       T01090                                 

Definition
cytochrome P450, putative
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
afv  Aspergillus flavus
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    AFLA_127500
  Amino acid metabolism
   00380 Tryptophan metabolism
    AFLA_127500
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     AFLA_127500
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     AFLA_127500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1103 aa AA seqDB search
MSTPKAEPVPIPGPRGVPLMGNILDIESEIPLRSLEMMADTYGPIYRLTTFGFSRCMISS
HELAAEVFDEERFTKKIMAGLSELRHGIHDGLFTAHMGEENWEIAHRVLMPAFGPLNIQN
MFDEMHDIATQLVMKWARQGPKQKIMVTDDFTRLTLDTIALCAMGTRFNSFYSEEMHPFV
DAMVGMLKTAGDRSRRPGLVNNLPTTENNKYWEDIDYLRNLCKELVDTRKENPTDKKDLL
NALINGRDPKTGKGMSYDSIIDNMITFLIAGHETTSGLLSFAFYNMLKNPQAYQKAQEEV
DRVIGRRRITVEDLQKLPYITAVMRETLRLTPTAPAIAVGPHPTKNHEDPVTLGNGKYVL
GKDEPCALLLGKIQRDPKVYGPDAEEFKPERMLDEHFNKLPKHAWKPFGNGMRACIGRPF
AWQEALLVIAMLLQNFNFQMDDPSYNIQLKQTLTIKPNHFYMRAALREGLDAVHLGSALS
ASSSEHADHAAGHGKAGAAKKGADLKPMHVYYGSNTGTCEAFARRLADDATSYGYSAEVD
SLDSAKDSIPKNGPVVFITASYEGQPPDNAAHFFEWLSALKGDKPLDGVNYAVFGCGHHD
WQSTFYRIPKEVNRLVGENGANRLCEIGLADTANADIVTDFDTWGETSFWPAVAAKFGSN
TQGSQKSSTFRVEVSSGHRATTLGLQLQEGLVVENTLLTQAGVPAKRTIRFKLPTDTQYK
CGDYLAILPVNPSTVVRKVMSRFDLPWDAVLRIEKASPSSSKHISIPMDTQVSAYDLFAT
YVELSQPASKRDLAVLADAAAVDPETQAELQAIASDPARFAEISQKRISVLDLLLQYPSI
NLAIGDFVAMLPPMRVRQYSISSSPLVDPTECSITFSVLKAPSLAALTKEDEYLGVASTY
LSELRSGERVQLSVRPSHTGFKPPTELSTPMIMACAGSGLAPFRGFVMDRAEKIRGRRSS
GSMPEQPAKAILYAGCRTQGKDDIHADELAEWEKIGAVEVRRAYSRPSDGSKGTHVQDLM
MEDKKELIDLFESGARIYVCGTPGVGNAVRDSIKSMFLERREEIRRIAKEKGEPVSDDDE
ETAFEKFLDDMKTKERYTTDVFA
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcccaaggccgaacccgttcccatcccggggccgcggggtgtgcctctgatg
ggaaacatcctcgatattgagagcgaaatccctctaagaagcttggaaatgatggcagat
acttatggtcctatctatcggttaacgacctttggattctcacgttgcatgatcagctcc
cacgagctggcagccgaggtgttcgatgaggagcgttttaccaaaaagattatggcaggc
ctcagtgagcttcgccacggtatccacgatggtttattcacggcccatatgggcgaggag
aattgggagattgcacatcgcgttttgatgcccgccttcgggcccctcaacatccaaaat
atgttcgatgaaatgcacgacattgcgacacagttggtgatgaagtgggctcgacaaggg
cccaagcagaaaatcatggtcacagatgatttcacccgccttacattggataccatcgcc
ctatgtgccatgggcacccgattcaattctttctatagcgaagagatgcatccctttgtg
gacgcaatggttgggatgttgaagactgcgggcgaccgctcccgtcgcccaggcttggtc
aacaacctgcctactactgaaaacaacaagtactgggaggatatcgactacctccgcaac
ctttgcaaggagcttgttgatacccgcaaagaaaatcctacggacaagaaagatttgctc
aatgctctaatcaatggccgtgacccgaagaccggcaagggcatgtcatatgactccatc
attgataatatgatcactttcctgattgctggacatgaaaccacctctggtttgctttcg
ttcgccttctacaacatgctcaagaacccccaggcatatcagaaagctcaggaggaagtg
gacagagtcattggacgccgcaggattaccgtcgaggacctgcaaaagctgccttacatt
actgctgtcatgcgtgaaaccttacgactcacccctactgcacccgctattgcagtcggc
cctcacccgaccaagaaccacgaggaccccgtcactcttggtaacggaaaatatgttctt
ggcaaagacgagccatgtgctctcttgttgggcaagattcagcgtgatcccaaggtgtac
ggccccgatgcagaggaattcaagccagagcggatgctggatgagcatttcaacaagctg
cctaagcacgcgtggaaacccttcggaaacggaatgcgagcatgtatcggtcggccgttt
gcctggcaggaagcgctcctcgtcattgcgatgttgttgcaaaacttcaacttccagatg
gatgatccgtcctacaacattcaactcaagcagacgctcaccatcaagcccaatcatttc
tatatgagagctgctcttcgcgagggcttggacgctgtgcacctaggatcagcattgagc
gctagcagcagcgagcatgcggatcacgctgccggccatggtaaggcaggcgccgctaag
aagggtgccgatttgaagcctatgcatgtatactacggtagcaacactggaacctgtgag
gcctttgcaagacgcctcgccgatgatgccactagctatggctactcggccgaggttgat
tcgctagattcggccaaagatagcatccccaagaatgggccggttgttttcatcaccgcg
tcttatgaaggacagcccccagataatgccgcccatttcttcgagtggctcagcgctttg
aagggcgacaaacccttggacggcgttaattatgctgtgttcggctgtggacatcacgat
tggcagtcaactttctaccgcattcctaaggaagttaaccgccttgttggcgagaatggc
gcaaataggctctgcgagatcggtctggccgacacagccaacgctgatatcgtcacggat
ttcgatacctggggtgaaacttcgttttggccagcagttgccgctaaattcggttcaaac
acccagggctcccagaagtcatccaccttccgtgtagaggtcagctcgggtcacagagca
actaccctcggtctccaactgcaagaaggtcttgtcgtggagaacacgctcctcactcag
gctggcgtgcctgccaagcggactattcgcttcaagctccctactgatacgcagtacaag
tgcggtgactacctggccatcctcccagtgaaccccagcactgtagtccgcaaagtcatg
agccgtttcgatcttccctgggacgccgtactccgcatcgagaaggcatctccctcatcc
tcgaaacacatttccatcccaatggatacccaagtctccgcctacgacctgttcgccaca
tacgtcgaactctcgcagcccgcatcgaagcgtgacctagcagtcctcgccgacgcagca
gccgtagaccccgaaacccaagccgaactacaggcgatcgcctccgacccagcccggttc
gccgagatctcccagaagcgcatcagcgtattggacctactgcttcaatacccctccatc
aacctcgcgatcggagacttcgtcgccatgctccctcccatgcgtgtccgccagtactcc
atctcctcctcccccttagtcgaccccaccgaatgctccatcaccttctccgtcctgaaa
gccccatccctcgccgccctcaccaaagaagacgaatacctcggcgttgcatcaacctac
ctttccgaactccgctccggcgaacgcgtccaactctccgtccgcccctcgcacactggc
ttcaagccccccaccgaactcagtaccccaatgatcatggcctgcgccggcagcggcctc
gcccccttccgcggcttcgtgatggaccgcgccgagaaaatccgcggccgtcgcagctcc
ggctccatgcccgaacaacccgctaaagcgatcctctacgccggctgccgcacccaaggc
aaggacgacatccacgccgacgagctggccgaatgggagaagatcggtgccgtggaagtc
agacgggcctacagccgtcccagcgacgggtcgaagggcacacacgtgcaggatctcatg
atggaagataagaaggagctcattgatctctttgagagcggggctaggatctatgtctgt
ggtacgccgggcgtgggtaatgccgtccgggattcgattaagagtatgttcctcgagaga
cgggaggagattcgtcgcattgcgaaggagaagggcgagcctgtttcggacgatgatgag
gagacggcgtttgagaagttcttagatgacatgaagactaaggagcggtatactacggat
gtttttgcttaa

DBGET integrated database retrieval system