KEGG   Aspergillus flavus: AFLA_129370Help
Entry
AFLA_129370       CDS       T01090                                 

Definition
cytochrome B5, putative
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
afv  Aspergillus flavus
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AFLA_129370
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     AFLA_129370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 474 aa AA seqDB search
MPSFTLEQVQKHCKPDDVWFVLHNKVYDVTKYLEDHPGGNAILLEVAGTDATEAFEEVGH
SDEAREQLEPFYVGDLPTEEHTESVEIYRPTYEQVSQSAAVNVKTSTSWSSIIQTIIKCA
MTGLAGKSAITVYRRGITTTEIAHALRSLTTSISPRQGPGHDGSHFWAGVGIASAVQFSL
TLGLGMWISTKLDVQQEFTHHVPRRPAKPARMIRLSRTNIPIKKPSVLDPRKWRSFTLTS
KTEVAPHVYRFIFALPNPDDVLGLPTGQHIALRATINGQSVSRSYTPVSNNSDLGRIELL
IKVYPNGAMTQHLEQMKVGDSIKIRGPKGAMQYSRQYAKHIGMIAGGTGITPMYQLIRAI
CEDDSDKTQVSLLYANNTEEDILLRTELDNFARYHPEKFQVQYVLSHPGETWQGYQGFVN
GDLIAKHLAPAALENKVLLCGPPPMVAAMKKTLQGMGWTIPGAVAKAGDQVFLF
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccttcacccttgaacaggtccaaaaacactgcaaaccggacgatgtctggttt
gtcctccacaacaaggtctacgatgtgaccaaatatcttgaggatcaccccggtgggaat
gccattcttcttgaggtcgctggcaccgatgctacagaagctttcgaggaagtcggacac
tctgacgaagcccgggaacagttagagcctttctacgtaggcgacttaccgacagaggaa
catactgaatctgtcgagatctaccgcccaacatacgaacaagtctcacaatctgcggct
gtcaacgtcaaaacctccacctcctggtcatccataatccaaacaatcataaaatgcgcc
atgaccggtctagcaggcaaatccgccataacagtctaccgccgtggcataaccaccacc
gagatagctcacgctctgcgctccctcaccacatccatctctccccgccagggcccgggc
cacgacggatcccatttctgggccggcgtaggcatcgccagtgcagtccagttctcccta
accctgggcctgggaatgtggatttcgaccaagctagacgtgcagcaagaattcacccat
cacgttccccgtcggccagccaaaccagcacgtatgatccgactctcccggaccaatatt
ccaatcaagaaaccgagtgtcctggatccgcgcaaatggcgatcattcaccttgaccagc
aaaactgaagtcgcaccacatgtatatcgattcatctttgcgctgccaaatccggatgat
gtcctcggcctaccgacgggccaacacattgctctacgagcaacgatcaacggacaaagc
gtctcgagatcgtacacaccggtatccaacaacagcgacctaggtcgcatcgagctactc
atcaaagtataccccaacggagcgatgacccagcatttagagcagatgaaagtaggcgac
tcaatcaagatccgcgggcccaagggcgcaatgcaatattcccggcaatatgcgaagcac
atcgggatgatcgcaggtggaacaggaattacaccaatgtaccagctcattcgggcaatc
tgcgaagatgacagcgacaagacgcaggtgtcactgctgtacgcgaataacacggaagag
gacattctgctgcgcacggagctagataacttcgcgaggtatcatcctgaaaaattccag
gtgcagtatgtgctgagccaccccggggagacgtggcagggttatcaggggtttgtgaat
ggggatcttattgcgaagcatttggcgcctgctgcgctggagaataaagtgttgctgtgc
gggccgccgccgatggtggcggcgatgaagaagaccctgcaagggatgggatggacgata
cctggggctgttgctaaggctggggatcaggttttcttgttttag

DBGET integrated database retrieval system