KEGG   Aspergillus flavus: AFLA_129680Help
Entry
AFLA_129680       CDS       T01090                                 

Definition
histone acetyltransferase (Esa1), putative
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
afv  Aspergillus flavus
Brite
Enzymes [BR:afv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AFLA_129680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 506 aa AA seqDB search
MGVRDSHGEATATPDPVEKGFATLNTIRIGVKAMVQKDGELRKAEILSIRQRKDGPSFYV
HYVDFNKRLDEWIDSTRIDLSHEVEWPQPEKPEKKKAGPGNKAPSKNAQKRARAGSREVS
ATPDLLTGKNTNIGKAQRPSKAGGKENRDETPANLSVLDSEAISADVTPKPEMEDVDMIG
VSFTDTKEEHEQGKMSREEEIERLRTSGSMTQNPTEIHRVRNLNRLQMGKFDIEPWYFSP
YPASFSDVDMVYIDEFCLSYFDNKRAFERHRSKCTLVHPPGNEIYRDDRISFFEVDGRRQ
RTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMATRDETGCHLVGYFSKEKDSAEGYNLAC
ILTLPQYQRLGYGRLLIAFSYELSKREGKLGSPEKPLSDLGLLSYRQYWRETLVELLIEP
GRESMSENELAVLTSMTEKDVHETLVVFNMLRYHKGNWVIVLTDQVVEQHNKRLEKEKIK
GSRKIDPARLQWKPPVFTASSRTWNW
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcagagattcccatggggaggcaaccgcgacgccggaccccgttgagaagggg
ttcgccaccctcaacaccattcgaatcggtgttaaggccatggttcagaaggatggagaa
ttgagaaaagctgaaattttgtctatcagacagcgcaaagatggtccaagcttttacgtc
cattatgtcgatttcaataaacgtctcgacgagtggatcgattccacaaggattgattta
tctcacgaggttgaatggccgcagcctgaaaaaccagagaagaagaaagcaggtcctggt
aataaagcaccgagcaagaatgctcagaagcgtgcaagagccggaagccgcgaggtttcg
gcaaccccagatctcttgacaggcaaaaacaccaatattggcaaagcacagcgtccgtct
aaggcaggcgggaaagagaaccgtgacgagacgcctgcaaatttgtcagttctagattcg
gaagccatttctgcagacgtgacccctaagcctgaaatggaagatgttgatatgatcggc
gtcagtttcacggataccaaggaagagcatgaacaaggtaaaatgtcacgcgaagaggaa
atcgaacgattgcgtacaagcggaagtatgacccaaaatcccacggaaattcaccgtgtg
cgtaacttgaatcgtctacaaatgggcaagtttgacattgagccgtggtacttctctcct
tatcctgcctcgttctcggatgtcgatatggtctacattgatgaattctgcttgagttat
ttcgacaacaaacgcgctttcgagcgtcaccgttcgaaatgtacacttgttcacccacct
gggaacgagatctatcgtgatgaccgtatatcattctttgaagtggacggtcggcgccag
cgcacctggtgccgcaatctttgccttcttagcaaactctttcttgaccataaaacactc
tactacgacgtcgaccctttccttttctactgcatggccactcgggatgagaccggttgc
catctggtgggctatttctccaaagaaaaagattccgcagaaggttataaccttgcttgt
atcttgaccttaccacaataccagcgtctcggctacgggcgactgcttattgctttcagc
tatgagctcagcaagcgagaaggaaagcttggctctccagaaaagcccctcagtgacctg
ggtctgctaagttatcggcaatactggcgagaaacactcgtggagttactcatagagccg
ggccgagagtccatgagtgagaacgaacttgctgtgttaacgtctatgaccgagaaggat
gtgcatgagacactggttgtgttcaatatgcttagataccacaaaggaaactgggttatc
gtcctcacggatcaagttgtggagcaacacaataagcgtcttgagaaagagaaaattaaa
gggtcgcgcaaaatcgaccctgcacgcttacaatggaagcctccagttttcacagcttca
agtcgaacatggaattggtga

DBGET integrated database retrieval system