KEGG   Aspergillus flavus: AFLA_129740Help
Entry
AFLA_129740       CDS       T01090                                 

Definition
ubiquitin C-terminal hydrolase L3
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
afv  Aspergillus flavus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 250 aa AA seqDB search
MTDHVDVPETNKAFVPLENNPEVMSHLVHQLGLPPSLGFTDVYSIDEPDLLAFVPRPSHA
LLLVFPVSKTYESSRMSEDSKLTDYTGSGPSEPVMWFKQTIRNACGLIGLLHAVSNGEAR
KQVLPGSDLDGLLRDAEPLSPIDRANLLYESKALESAHADAAKLGDTTAPQAEDSVDLHF
VAFVKGVDGRLWELDGRRKGPLERGKLDEDEDALSEKALELGVRRFLKTEAQGGNPDLRF
SLVSLGPVFD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccatgtcgatgtcccagaaaccaacaaggccttcgtgcccctcgaaaacaac
ccagaagtgatgtcgcacttagtccaccagctcggtctcccaccaagcctaggcttcaca
gacgtatactcaatcgacgagccagacctcctagccttcgtcccccgtccctcgcacgcc
ctcctcctcgtcttccccgtctccaaaacctacgaatcgtcccgcatgtccgaagacagc
aagctcaccgactatactggctcgggaccttcggaacccgtcatgtggttcaaacagacg
atccggaatgcttgcggtttgatcggattgttgcacgctgtgtccaatggagaggctcgg
aaacaggtccttcctggatctgatttggatgggcttttgcgggatgcggagccgcttagt
cctatcgacagagcgaatctactatatgagagcaaggcgctagagagtgctcatgctgat
gcggcgaagttaggtgatactacggcgccccaggcagaggattccgttgacttgcacttt
gttgcgtttgtgaagggggttgatggaaggttgtgggagctggatgggaggaggaagggt
ccgttggaaaggggaaagttggatgaggatgaggatgcattgagcgagaaggcgctcgag
ctgggagttaggaggttcttgaagactgaggctcagggtggtaacccggacttgaggttc
agtttggtcagtttggggcctgtttttgattaa

DBGET integrated database retrieval system