KEGG   Aspergillus flavus: AFLA_129920Help
Entry
AFLA_129920       CDS       T01090                                 

Definition
(RefSeq) agmatinase, putative
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
afv  Aspergillus flavus
Pathway
afv00330  Arginine and proline metabolism
afv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AFLA_129920
Enzymes [BR:afv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     AFLA_129920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 7911597
NCBI-ProteinID: XP_002382185
UniProt: B8NPC0
Position
Unknown
AA seq 416 aa AA seqDB search
MKYTLGLLALAGTALSHAHHDDTEVVPEHLREELLKKWDQEWTFSGIASFAHLKPVKCLI
EPDERYDIAVIGAPFDTAVSYRPGARFGPRAIRAASARQMAGTAYNTRAGINPYSSWATV
KDCGDIPIIPFDNGVAERQMYEAFLELGSRSPITPADSKYGTKGISAGKAKLVTLGGDHS
VALPALRALYQIYQKPITVLHFDAHLDTWNPVRYSAYWTSEQSAFNHGSFFHKASREGLI
CNSTSAHAGLRTRLTGVTDSDYTNPGPEQGFMRIHADDIDDLGPMGIVDKIIERIGLDSE
QPVYLSVDIDVLDPATAPGTGTPEPGGWTTREFIRIMRGIEKLNIVGADIVEVSPSYDNK
GETTALAAAQVAFEIITSMVKAGAGEDLGGWYGRKEEKIDESAKEGEAKKEGKDEL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataccctggggttgctggctctggccggtactgccttatctcacgcccatcac
gatgacacggaagtggttcctgagcacttgcgtgaggagctgttgaagaaatgggatcaa
gagtggacattttctggcattgctagctttgcgcacctaaaaccagtcaaatgtctaatc
gaaccagatgagcgatatgatatcgccgtcatcggagcccccttcgatactgctgtcagc
tacagaccaggagctcgttttggtcctcgtgccattcgtgctgctagcgcccgccagatg
gccggtacagcctataacacccgtgcgggcatcaatccctacagctcgtgggccaccgtc
aaggactgtggggatatccctataattcccttcgacaatggcgtagcggagcgccaaatg
tacgaagctttcctcgagctgggctcacgatctcccattacccctgccgactccaagtac
ggcactaagggcatctctgccgggaaggcgaagctggtcaccctgggaggtgatcacagt
gttgcgctaccggctctccgtgccctgtatcaaatctaccaaaagcccatcacagtgctg
catttcgatgcacatctagacacctggaatcccgttcgctactcggcatactggacatca
gaacagtcggcgtttaatcacggcagtttcttccacaaggcgagtcgtgagggtctcatt
tgcaactcgacctctgctcatgctggtctgcgcactcgtttgactggtgtcaccgatagc
gactacaccaacccgggccccgagcagggattcatgcgcatccatgctgacgacattgac
gacctaggccccatgggcatcgtggataaaataattgagcgcatcggtctggattcggag
caacccgtgtatctgtcggtggacattgacgtgcttgaccccgcgactgcccccgggacc
ggtactcccgagcctggcggctggaccacccgtgagttcatccggatcatgcgcggcatt
gagaagttaaacattgtcggcgcggacatcgttgaggtatcgccaagttacgacaacaag
ggagagaccaccgctctcgcagctgcccaagtggcctttgagatcatcaccagcatggtc
aaggcgggagctggcgaagacctgggaggatggtatgggcgcaaggaagagaagatcgat
gagtctgcaaaggagggagaagcgaagaaagaaggcaaagacgagctgtaa

DBGET integrated database retrieval system