KEGG   Aspergillus flavus: AFLA_130310Help
Entry
AFLA_130310       CDS       T01090                                 

Definition
protein disulfide isomerase Pdi1, putative
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
afv  Aspergillus flavus
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:afv00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AFLA_130310
Enzymes [BR:afv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AFLA_130310
Exosome [BR:afv04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AFLA_130310
  Exosomal proteins of colorectal cancer cells
   AFLA_130310
  Exosomal proteins of bladder cancer cells
   AFLA_130310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 515 aa AA seqDB search
MRTFAPWILSLLGASAVASAADATAEAPSDVVSLTGDTFETFVKEHDLVLAEFFAPWCGH
CKALAPKYEQAATELKEKNIPLVKVDCTEEEALCRDQGVEGYPTLKIFRGLDAVKPYQGA
RQTEAIVSYMVKQSLPAVSPVTPENLEEIKTMDKIVVIGYIASDDQTANDIFTTFAESQR
DNYLFAATSDASIAKAEGVKQPSIVLYKDFDEKKATYDGEIEQDALLSWVKTASTPLVGE
LGPETYSGYITAGIPLAYIFAETKEEREQFTEEFKSIAEKHKGSINIVTIDAKLYGAHAG
NLNLDPSKFPAFAIQDPEKNAKYPYDQSKEVKAKDIGKFIQDVLDDKVEPSIKSEAIPET
QEGPVTVVVAHSYKDLVLDNEKDVLLEFYAPWCGHCKALAPKYEELASLYKDIPEVTIAK
IDATANDVPDSITGFPTIKLFAAGAKDSPVEYEGSRTVEDLANFVKENGKHKVDALEVDP
KKEQESGDATETRAASDETETPAATSDDKSEHDEL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgcggactttcgcaccttggatcttgagccttctaggggcttctgctgtagcttctgct
gccgatgcgactgccgaagctccctccgatgtggtctcgctcaccggggacacattcgaa
actttcgtcaaggagcatgacctagttttggccgagttttttgctccctggtgtggccat
tgcaaggctctcgctccgaaatacgagcaggccgccactgagttaaaggaaaagaacatt
ccgctggtcaaggttgattgcaccgaggaagaggctctttgtagggaccaaggtgttgaa
ggttaccccacgctgaagattttccgtggccttgacgctgttaagccttatcagggagct
cgtcagaccgaggcgattgtttcatacatggtcaagcagtcactacctgctgtgtcccct
gtcaccccagaaaacctcgaagagatcaagactatggacaagattgtcgttattggttat
atcgcgtctgacgaccagactgccaatgatatattcaccacttttgccgagtcacagaga
gacaactacctcttcgccgccacaagtgatgcatcgatcgctaaggcagaaggtgttaag
caaccttcgattgttctctataaagacttcgatgaaaagaaagctacttatgatggagag
attgaacaggatgccctcctcagttgggtcaagactgccagtacccccttggtgggcgag
ctgggcccagagacttactccggatatataacggctggcattccactggcgtacattttc
gccgaaaccaaagaagagcgtgagcagttcaccgaggagttcaagtccatcgccgagaaa
cacaagggttccatcaatattgtcaccattgacgccaagttgtacggcgctcatgcaggc
aatctcaaccttgacccctccaagttccctgcattcgctattcaagaccctgaaaagaac
gccaagtatccttatgaccagtcgaaggaagtcaaggccaaggatatcggtaaattcatc
caagacgttcttgatgataaagtagagccaagcattaagtctgaggctattcctgagact
caggaaggtccggttactgttgttgtcgcgcattcctataaggatctcgtccttgacaac
gagaaggacgtccttctcgaattttatgcgccatggtgcggacactgcaaggcccttgcc
ccgaagtacgaggaacttgcaagcctttacaaggatattcctgaagttaccatcgccaaa
attgacgcaacggccaacgatgtccccgactccattacaggatttcctactattaagctc
ttcgctgccggcgccaaggactccccagttgaatatgaaggctctcgcacggtggaggat
ctcgccaactttgtcaaggagaatggcaagcacaaggtcgatgctcttgaagttgatccg
aagaaagaacaggagagtggcgatgccaccgagactcgggccgcttctgacgagaccgaa
actcctgctgctactagcgatgacaagtctgagcatgatgaattgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system