KEGG   Aspergillus flavus: AFLA_131880Help
Entry
AFLA_131880       CDS       T01090                                 

Definition
(RefSeq) catecholamine-O-methyltransferase, putative
Organism
afv  Aspergillus flavus
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24
Motif
Other DBs
NCBI-GeneID: 7916696
NCBI-ProteinID: XP_002379202
UniProt: B8NG27
Position
Unknown
AA seq 281 aa AA seqDB search
MPYKPEEEIYVRDIPLSYMWKYLKTNQPPPKKCNDGREQELLKFIQNHPRYSEMKGSPEA
VLAAIDEFGCTKDFLMNVGQEKGRVVTGLIAQEKPKTFLEIGGYVGFSAILFGNEFRNSG
GQKYLSLELNPTFASVARELIALAGLDQTVEIIEGPCRESLRKLHQQGAGAFDVVFIDHA
KVLYFNELKLCEELGFVQPGTTVMADDMVRQGNAQYSAYVRDSPAVKRQRYEEEKANQEN
GDVSLGNPSLIYETTMFHGLDPCGTEVSQPAGWQVISRMKF
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgccctacaagcccgaagaggaaatttatgtgcgtgatataccactctcatatatgtgg
aaatatctcaaaactaaccaaccccctccaaaaaagtgtaatgatggaagagaacaagaa
ctactcaaatttatccaaaaccaccccagatattccgagatgaaaggctcccctgaagcc
gttctcgctgcgatagacgagttcggctgtacaaaagatttcctcatgaacgtgggccaa
gagaaaggtcgcgttgtgaccggtcttatagcccaggagaaacccaagacttttctcgag
attggcggatatgtaggattttcagccattctctttgggaacgagtttcgcaattcaggt
ggccagaaatacctgagtcttgagctgaaccctacttttgcgtccgtggcccgcgagttg
attgcgctggcggggttggatcagacggtggagattattgaaggtccttgtcgggagtcc
ttgcggaaacttcaccagcagggcgcgggcgcgtttgatgtggtcttcattgatcatgct
aaagttctgtacttcaatgagctgaaactatgcgaggagttgggcttcgtacaaccaggc
accaccgtcatggccgatgacatggttcgacagggaaacgctcaatactcggcatatgtg
agagattctcctgcggtgaagaggcagcggtacgaggaagagaaagcaaaccaggaaaac
ggagatgtgtctctgggtaacccttcgttgatttacgagactactatgttccacggcctt
gacccttgtggcactgaggtaagtcagcctgctggatggcaagttatttcaagaatgaaa
ttctaa

DBGET integrated database retrieval system