KEGG   Aspergillus flavus: AFLA_131880Help
Entry
AFLA_131880       CDS       T01090                                 

Definition
catecholamine-O-methyltransferase, putative
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
afv  Aspergillus flavus
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    AFLA_131880
Enzymes [BR:afv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     AFLA_131880
Exosome [BR:afv04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AFLA_131880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 281 aa AA seqDB search
MPYKPEEEIYVRDIPLSYMWKYLKTNQPPPKKCNDGREQELLKFIQNHPRYSEMKGSPEA
VLAAIDEFGCTKDFLMNVGQEKGRVVTGLIAQEKPKTFLEIGGYVGFSAILFGNEFRNSG
GQKYLSLELNPTFASVARELIALAGLDQTVEIIEGPCRESLRKLHQQGAGAFDVVFIDHA
KVLYFNELKLCEELGFVQPGTTVMADDMVRQGNAQYSAYVRDSPAVKRQRYEEEKANQEN
GDVSLGNPSLIYETTMFHGLDPCGTEVSQPAGWQVISRMKF
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgccctacaagcccgaagaggaaatttatgtgcgtgatataccactctcatatatgtgg
aaatatctcaaaactaaccaaccccctccaaaaaagtgtaatgatggaagagaacaagaa
ctactcaaatttatccaaaaccaccccagatattccgagatgaaaggctcccctgaagcc
gttctcgctgcgatagacgagttcggctgtacaaaagatttcctcatgaacgtgggccaa
gagaaaggtcgcgttgtgaccggtcttatagcccaggagaaacccaagacttttctcgag
attggcggatatgtaggattttcagccattctctttgggaacgagtttcgcaattcaggt
ggccagaaatacctgagtcttgagctgaaccctacttttgcgtccgtggcccgcgagttg
attgcgctggcggggttggatcagacggtggagattattgaaggtccttgtcgggagtcc
ttgcggaaacttcaccagcagggcgcgggcgcgtttgatgtggtcttcattgatcatgct
aaagttctgtacttcaatgagctgaaactatgcgaggagttgggcttcgtacaaccaggc
accaccgtcatggccgatgacatggttcgacagggaaacgctcaatactcggcatatgtg
agagattctcctgcggtgaagaggcagcggtacgaggaagagaaagcaaaccaggaaaac
ggagatgtgtctctgggtaacccttcgttgatttacgagactactatgttccacggcctt
gacccttgtggcactgaggtaagtcagcctgctggatggcaagttatttcaagaatgaaa
ttctaa

DBGET integrated database retrieval system