KEGG   Aspergillus flavus: AFLA_132490Help
Entry
AFLA_132490       CDS       T01090                                 

Definition
D-amino acid oxidase
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
afv  Aspergillus flavus
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AFLA_132490
   00330 Arginine and proline metabolism
    AFLA_132490
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    AFLA_132490
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    AFLA_132490
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    AFLA_132490
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     AFLA_132490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 364 aa AA seqDB search
MSTNNIVILGAGVSGLTTAYLLSKDASNSITVLAKHMPGDYDIEYASPWAGANYLPVGKA
SSSHGKWERNTWPALKEITEKYPEAGIHFQDAIVYNRTKDQGSATGDWFSELVQKEPWYK
DVVPDFRNFPDNELAPGIDNASVFTSVCINTAIYLPWLIGQCRKTGVVFKRAVIKHVADA
ASLHHSGKKADVVVNCTGLSSRKLGGVNDDKLHPIRGQIVVVRNDPGAMFSISGTDDAED
EVTYMMTRAAGGGTVIGGSYQKDQWDPLPDPNLAVRIMKRAIALVPQLVGEGQGIEGLDV
IRHGVGLRPFREDGPRIEADKVNGVSVVHNYGHGGFGYQASFGCAAEAVELVNGVLKQKG
RAKL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaaataacatagtgatcctgggagccggagtgtcgggactcaccacggcatat
ctcctgtctaaagatgcctccaattcaatcacagtgctcgccaaacatatgccgggcgac
tacgacatagaatacgcctcgccgtgggcaggtgccaattatcttccggtgggcaaagcc
agtagctcccatgggaaatgggaacgaaacacctggcctgccctcaaggaaataacggaa
aagtacccggaggctggaattcatttccaagatgcgattgtctataatcgtacgaaagat
caaggatcagcaaccggagattggttctccgaattggtgcagaaggaaccttggtataaa
gatgtcgtaccagatttccgcaattttcccgacaatgagctagcgcccggcattgacaac
gcctcagtgttcacttccgtctgcatcaacacagcgatctacctaccctggctaattggc
caatgccgcaagaccggtgtggtcttcaaacgagcagtgatcaagcatgtcgcggacgca
gccagcctccatcattcaggaaaaaaagccgacgtggtagtcaactgcaccggcctttcc
tccagaaagctaggtggcgtcaacgacgacaagctccaccccatccgtggccagattgtc
gtggtccgcaacgatcctggtgcaatgttctccatctccggcactgacgacgccgaggac
gaggtaacctacatgatgacccgggcagcgggcggtggaactgtcatcggaggctcgtat
cagaaggaccagtgggatccgctgcctgacccgaacctggccgtgcgcatcatgaagcgc
gctattgctctcgtcccccaactcgtgggtgagggccaaggaattgagggattagatgtc
atcagacacggtgttggactacgacccttccgtgaggatggaccacgtattgaagcagat
aaggttaatggtgtctcggtcgttcataactacggccatggaggatttggatatcaagct
tccttcggctgtgccgcggaggcagtcgagttggttaacggcgtcttgaaacagaagggt
cgggctaagctgtaa

DBGET integrated database retrieval system