KEGG   Aspergillus flavus: AFLA_133610Help
Entry
AFLA_133610       CDS       T01090                                 

Definition
TORC1 growth control complex subunit Kog1, putative
Orthology
K07204  
regulatory associated protein of mTOR
Organism
afv  Aspergillus flavus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1394 aa AA seqDB search
MKDPNLIMEQKATMEPQETSGHAEPRKNTTKSVRVAFGPDLETHIPPRDKSPAPGPGHHR
SFTTVERRHPPVTTPDRPTSSSAGEGPAVIDDNPRLTSDRASDSARPSTLKRAKSDYGPR
LGFEKSPGEDEEDFAMRHGWQEEYTSSEYLKILHSNFYMYFTEKRHETNGMPRDPVGSWP
SQDWRMKDRLKTVSAALAICLNIGVDPPDVVKTNPTAKLECWVDPTSTTGGGQTKIMEQI
GKKLQEQYETLSLRTRYKQYLDPSVDETKKFCISLRRNAKDERVLFHYNGHGVPLPTQSG
EIWVFNKNYTQYIPVSLYDLQSWLAGPSLFVFDVSHAGNIVQNFHTFVEKHEKENIEAKK
RDPNVITQNYGDCIILAACQKSESLPTNPDLPADLFTCCLTTPIEIALRYFILQNPLQSN
ISIDDFRVPGRLQDRRSPLGELNWIFTAITDTIAWNTLPRALFKKLFRQDLMVAALFRNF
LLSERIMRTYKCHPISSPELPETHHHPLWKSWDLAVEMVLAQLPALIDHEEGRRQYEYQH
STFFAEQLTAFEVYLSSGPTEKTPPDQLPIVLQVLLSQAHRLRALILLSKFLDLGPWAVH
LALSIGIFPYVVKLLQSAAQELKPVMVFIWARIMAVDHTVQNDLLKDNGIHYFISILNPS
SPIPVGNASEHRAMCAFIVSIFCKNYPQGQNVCLSAELFDSCLRHLMDVENPLLRQWSCL
CISMLWSDFPEAKWMGIRCAAPARLCELNFDPVPEVRAAMLHAVTTFLGIPDLTDQVAQI
EESLAMAVLPMASDGSVLVRKELLVFFSTFVRRYQNKFLVAAYDELQDEKQSLLSKVEQA
TPRGHSFEDAPNGSANGSLSSYKTQKLSRNSTFGTIWKQLLILSVDPHPDIAQDAATIVD
YIHLSLVQSPMASLTEKIRQEIMDLSNSLSQKTQIRERLESKKTAPPPAPPSVAPPKQEG
YLSLSLKRTASVAASLKNLAFGGSLTEPQSPQLSASDKSRMPMTPRGRAPPEWTRPPEFL
THIQYFREPQMKPNEPDEPGSADYNERLWRRSRNERIITETQPLKSKAGSSRWDTSIALL
SNSSQPMKMCFHQFEDHIAVADDKDTIAIWDWQSHKRLNRFSNGNPPGSKINEVRYINED
DQALLLTGSSDGVLKIFRNYESARDVEIVTAFRALPELIPSNRNAGLVLDWQQGQGKALV
AGDVKVIRVWNAATEVCTNDIPARSGSCITSLTSDQVAGNIFVAGFGDGAVRVFDQRIKP
TTSMVKVWREHKQWITNVHMQRGGLRELVSGSRNGEIRLWDLRMDNPISTLYATKDTLRT
LSVHEHAPVFMVGTNRHEVKTFNVDGTFLSTFEPYSSFLHHNRSSPIASTAFHPHRTVLA
CAALNDNHINLVSC
NT seq 4185 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatcccaatttgattatggaacagaaagccactatggagccccaagaaaccagc
ggtcatgctgaaccccgaaagaacaccaccaaatccgtccgcgtggccttcggtccggac
ctggaaacgcatatccctcctcgcgataagtcacccgcgcctgggccaggacaccacaga
tcgtttactaccgtggagcggagacacccccctgtaaccacccctgacagaccgacgagt
tcctcggcaggtgaaggcccagccgtcatagatgataaccctcggttaacatctgatcgg
gcatcggattcagcacggccgtcgacattgaagcgggctaaaagcgactatggaccaaga
ctggggtttgaaaagtctcctggagaggatgaagaggactttgccatgcgccatggatgg
caggaagagtacacttcgagcgaataccttaaaatcttacactcgaatttttacatgtat
ttcacggaaaaacgccatgagacaaacggcatgccgagagatcccgtgggaagctggccc
agccaggactggcgtatgaaggaccgtttgaaaaccgtttctgcggccttggctatatgc
ttgaacatcggtgttgatcccccggatgtggtcaagacgaaccctacggctaagctcgaa
tgctgggttgacccaacatcgactactgggggcgggcagaccaagatcatggagcagatt
ggaaaaaagctacaggaacaatatgaaacacttagcctaagaactaggtacaagcagtat
ctcgacccatctgttgatgagacgaaaaagttttgcatatctctacgtcgtaacgccaaa
gacgagagagttcttttccattataacggccatggtgtccctttacccacccagtctggt
gaaatatgggtcttcaacaaaaattatactcagtacatcccggtgtccttgtatgatttg
cagtcctggcttgcaggccccagccttttcgtttttgacgtatcacatgctgggaatatt
gtccagaattttcacacctttgtcgagaaacatgaaaaagagaatatcgaagcaaagaag
cgggaccctaatgtgatcacccaaaactatggggattgcataatcctcgccgcgtgccag
aagagcgagtcgcttccaaccaaccctgacctccccgcagatcttttcacttgttgtttg
acgacgcccatcgagatcgctctgagatacttcatcctccagaatcctctgcagagtaac
atctccattgatgatttccgagtcccgggtcgtttgcaggaccgcaggagcccccttgga
gaactaaactggattttcactgctattacggacacgatcgcgtggaataccttgccccga
gctctctttaagaagctcttccgtcaagatttaatggtagcggccctttttagaaatttc
ctccttagcgaacggatcatgcgcacatacaagtgccatccaatatcgtcacctgaactg
ccagagacacaccatcatcctctgtggaaaagctgggatctagccgttgaaatggttttg
gctcagcttcctgcgctcattgatcatgaagaaggtcgtagacaatatgaataccaacac
tctacctttttcgctgagcagcttactgcttttgaggtgtacttgtcatctggacccaca
gagaaaaccccgccggatcagctacctattgtcctgcaagtccttttgagtcaggctcac
cgattgagggccctgattttactcagtaagttcctggacttgggaccctgggccgtccat
ctggctttgagcataggtatcttcccttacgtcgtcaagctcctacagtcggcagctcag
gagctgaagcctgttatggttttcatatgggcaagaatcatggcggtggaccatacagtc
cagaatgatctgctgaaggacaacggaatccactacttcatttctattctcaacccgtca
tcacccatacccgtcggaaacgctagcgaacatcgggccatgtgtgcattcattgtgtcg
atattttgcaaaaattatccccaaggccagaatgtgtgtctctcagcagaactctttgac
tcttgcttgaggcatctgatggatgttgagaatcctttactgcgccaatggtcatgtctt
tgcattagcatgctttggtctgatttccctgaggcaaagtggatggggattcgatgcgcg
gcacctgcaagactctgcgagctcaattttgatcctgtcccggaggtccgagccgcaatg
ttacatgccgtgacgacattcttgggtatccccgatttgacagatcaagtggcacagatc
gaagaatccttagccatggccgtgttaccaatggcatccgatggtagtgtactcgttcga
aaagaacttctggtattcttctcgactttcgtgagacgctatcaaaacaagttcctagtt
gccgcatatgacgagcttcaggatgagaagcagagccttctctccaaagtcgagcaagcg
acacctagaggtcattcctttgaggatgcaccgaatggctccgcaaatggctcgctttcg
agctacaagacacagaagctctctcgtaattctacttttggcaccatttggaaacagctc
cttatcctgtctgttgacccacatcctgacatcgcacaggatgcagctacaattgttgat
tacattcatttgtcccttgtgcaatcccccatggcatcgctaactgaaaaaattcggcaa
gaaataatggacctctcaaacagcttgtcacagaagacgcagatccgggaaagactagag
tcgaagaagactgcaccaccgccggctcctccgtcggttgctccaccaaaacaggaaggc
tatctttctctgagtttaaagcggactgctagtgtcgcggcgtccctaaaaaaccttgcc
tttggaggttcattaacagagccgcaatcgccgcaactttcagcctctgataagagtcgc
atgcccatgacgccacgaggacgagcccctccggaatggacccggccccccgaatttctc
acccatattcagtatttccgggagccccagatgaaacccaatgagcccgatgaacccggt
agcgcggactacaacgaacgcctttggagaagaagccgtaacgaaaggatcatcacagag
acgcagcccctcaagagtaaagctggcagcagccgatgggatacttcaatagccctactc
tctaacagcagccagcccatgaagatgtgctttcaccagttcgaggatcatatcgccgtt
gcggatgacaaagatactattgcgatctgggactggcaaagccacaaacgtctcaatcgg
ttttctaacggaaatccaccagggtcaaagatcaacgaagtccgttacattaacgaagat
gatcaagcacttttattgacaggttcttctgatggagttttgaagattttcaggaattac
gagtccgcacgggatgtcgagatcgtgacggcttttagagctctgccagagcttattcct
agtaaccgaaacgctgggcttgttctcgactggcaacagggccagggtaaggcgctagtc
gcaggagatgtgaaagtcatacgagtatggaatgctgcaactgaagtttgcaccaatgac
atccctgctcgctcaggatcgtgcatcacttccctaacttccgatcaagttgcgggtaac
atcttcgtagctggattcggtgatggggcagtcagagtattcgatcaacgcatcaagccc
acgacttccatggtcaaagtatggcgcgagcacaaacagtggattaccaatgtccacatg
caacggggtggcctaagagagctggtgtctggtagtcggaacggtgagattcgactttgg
gatcttcggatggataatccaatttcgacgctgtacgccactaaagataccttgcgaacg
ttgagcgttcatgaacacgctccagtattcatggtcggcaccaaccgccatgaagtcaag
acattcaacgttgacggcacctttctgtcgacgttcgagccttactcgagtttcctccat
cacaaccgctcttctccgatcgcaagcaccgcattccatcctcaccgcacggttctcgcc
tgtgctgctcttaatgataatcatatcaatctggtttcctgctag

DBGET integrated database retrieval system