KEGG   Aspergillus flavus: AFLA_133610Help
Entry
AFLA_133610       CDS       T01090                                 

Definition
TORC1 growth control complex subunit Kog1, putative
Orthology
K07204  
regulatory associated protein of mTOR
Organism
afv  Aspergillus flavus
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1394 aa AA seqDB search
MKDPNLIMEQKATMEPQETSGHAEPRKNTTKSVRVAFGPDLETHIPPRDKSPAPGPGHHR
SFTTVERRHPPVTTPDRPTSSSAGEGPAVIDDNPRLTSDRASDSARPSTLKRAKSDYGPR
LGFEKSPGEDEEDFAMRHGWQEEYTSSEYLKILHSNFYMYFTEKRHETNGMPRDPVGSWP
SQDWRMKDRLKTVSAALAICLNIGVDPPDVVKTNPTAKLECWVDPTSTTGGGQTKIMEQI
GKKLQEQYETLSLRTRYKQYLDPSVDETKKFCISLRRNAKDERVLFHYNGHGVPLPTQSG
EIWVFNKNYTQYIPVSLYDLQSWLAGPSLFVFDVSHAGNIVQNFHTFVEKHEKENIEAKK
RDPNVITQNYGDCIILAACQKSESLPTNPDLPADLFTCCLTTPIEIALRYFILQNPLQSN
ISIDDFRVPGRLQDRRSPLGELNWIFTAITDTIAWNTLPRALFKKLFRQDLMVAALFRNF
LLSERIMRTYKCHPISSPELPETHHHPLWKSWDLAVEMVLAQLPALIDHEEGRRQYEYQH
STFFAEQLTAFEVYLSSGPTEKTPPDQLPIVLQVLLSQAHRLRALILLSKFLDLGPWAVH
LALSIGIFPYVVKLLQSAAQELKPVMVFIWARIMAVDHTVQNDLLKDNGIHYFISILNPS
SPIPVGNASEHRAMCAFIVSIFCKNYPQGQNVCLSAELFDSCLRHLMDVENPLLRQWSCL
CISMLWSDFPEAKWMGIRCAAPARLCELNFDPVPEVRAAMLHAVTTFLGIPDLTDQVAQI
EESLAMAVLPMASDGSVLVRKELLVFFSTFVRRYQNKFLVAAYDELQDEKQSLLSKVEQA
TPRGHSFEDAPNGSANGSLSSYKTQKLSRNSTFGTIWKQLLILSVDPHPDIAQDAATIVD
YIHLSLVQSPMASLTEKIRQEIMDLSNSLSQKTQIRERLESKKTAPPPAPPSVAPPKQEG
YLSLSLKRTASVAASLKNLAFGGSLTEPQSPQLSASDKSRMPMTPRGRAPPEWTRPPEFL
THIQYFREPQMKPNEPDEPGSADYNERLWRRSRNERIITETQPLKSKAGSSRWDTSIALL
SNSSQPMKMCFHQFEDHIAVADDKDTIAIWDWQSHKRLNRFSNGNPPGSKINEVRYINED
DQALLLTGSSDGVLKIFRNYESARDVEIVTAFRALPELIPSNRNAGLVLDWQQGQGKALV
AGDVKVIRVWNAATEVCTNDIPARSGSCITSLTSDQVAGNIFVAGFGDGAVRVFDQRIKP
TTSMVKVWREHKQWITNVHMQRGGLRELVSGSRNGEIRLWDLRMDNPISTLYATKDTLRT
LSVHEHAPVFMVGTNRHEVKTFNVDGTFLSTFEPYSSFLHHNRSSPIASTAFHPHRTVLA
CAALNDNHINLVSC
NT seq 4185 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatcccaatttgattatggaacagaaagccactatggagccccaagaaaccagc
ggtcatgctgaaccccgaaagaacaccaccaaatccgtccgcgtggccttcggtccggac
ctggaaacgcatatccctcctcgcgataagtcacccgcgcctgggccaggacaccacaga
tcgtttactaccgtggagcggagacacccccctgtaaccacccctgacagaccgacgagt
tcctcggcaggtgaaggcccagccgtcatagatgataaccctcggttaacatctgatcgg
gcatcggattcagcacggccgtcgacattgaagcgggctaaaagcgactatggaccaaga
ctggggtttgaaaagtctcctggagaggatgaagaggactttgccatgcgccatggatgg
caggaagagtacacttcgagcgaataccttaaaatcttacactcgaatttttacatgtat
ttcacggaaaaacgccatgagacaaacggcatgccgagagatcccgtgggaagctggccc
agccaggactggcgtatgaaggaccgtttgaaaaccgtttctgcggccttggctatatgc
ttgaacatcggtgttgatcccccggatgtggtcaagacgaaccctacggctaagctcgaa
tgctgggttgacccaacatcgactactgggggcgggcagaccaagatcatggagcagatt
ggaaaaaagctacaggaacaatatgaaacacttagcctaagaactaggtacaagcagtat
ctcgacccatctgttgatgagacgaaaaagttttgcatatctctacgtcgtaacgccaaa
gacgagagagttcttttccattataacggccatggtgtccctttacccacccagtctggt
gaaatatgggtcttcaacaaaaattatactcagtacatcccggtgtccttgtatgatttg
cagtcctggcttgcaggccccagccttttcgtttttgacgtatcacatgctgggaatatt
gtccagaattttcacacctttgtcgagaaacatgaaaaagagaatatcgaagcaaagaag
cgggaccctaatgtgatcacccaaaactatggggattgcataatcctcgccgcgtgccag
aagagcgagtcgcttccaaccaaccctgacctccccgcagatcttttcacttgttgtttg
acgacgcccatcgagatcgctctgagatacttcatcctccagaatcctctgcagagtaac
atctccattgatgatttccgagtcccgggtcgtttgcaggaccgcaggagcccccttgga
gaactaaactggattttcactgctattacggacacgatcgcgtggaataccttgccccga
gctctctttaagaagctcttccgtcaagatttaatggtagcggccctttttagaaatttc
ctccttagcgaacggatcatgcgcacatacaagtgccatccaatatcgtcacctgaactg
ccagagacacaccatcatcctctgtggaaaagctgggatctagccgttgaaatggttttg
gctcagcttcctgcgctcattgatcatgaagaaggtcgtagacaatatgaataccaacac
tctacctttttcgctgagcagcttactgcttttgaggtgtacttgtcatctggacccaca
gagaaaaccccgccggatcagctacctattgtcctgcaagtccttttgagtcaggctcac
cgattgagggccctgattttactcagtaagttcctggacttgggaccctgggccgtccat
ctggctttgagcataggtatcttcccttacgtcgtcaagctcctacagtcggcagctcag
gagctgaagcctgttatggttttcatatgggcaagaatcatggcggtggaccatacagtc
cagaatgatctgctgaaggacaacggaatccactacttcatttctattctcaacccgtca
tcacccatacccgtcggaaacgctagcgaacatcgggccatgtgtgcattcattgtgtcg
atattttgcaaaaattatccccaaggccagaatgtgtgtctctcagcagaactctttgac
tcttgcttgaggcatctgatggatgttgagaatcctttactgcgccaatggtcatgtctt
tgcattagcatgctttggtctgatttccctgaggcaaagtggatggggattcgatgcgcg
gcacctgcaagactctgcgagctcaattttgatcctgtcccggaggtccgagccgcaatg
ttacatgccgtgacgacattcttgggtatccccgatttgacagatcaagtggcacagatc
gaagaatccttagccatggccgtgttaccaatggcatccgatggtagtgtactcgttcga
aaagaacttctggtattcttctcgactttcgtgagacgctatcaaaacaagttcctagtt
gccgcatatgacgagcttcaggatgagaagcagagccttctctccaaagtcgagcaagcg
acacctagaggtcattcctttgaggatgcaccgaatggctccgcaaatggctcgctttcg
agctacaagacacagaagctctctcgtaattctacttttggcaccatttggaaacagctc
cttatcctgtctgttgacccacatcctgacatcgcacaggatgcagctacaattgttgat
tacattcatttgtcccttgtgcaatcccccatggcatcgctaactgaaaaaattcggcaa
gaaataatggacctctcaaacagcttgtcacagaagacgcagatccgggaaagactagag
tcgaagaagactgcaccaccgccggctcctccgtcggttgctccaccaaaacaggaaggc
tatctttctctgagtttaaagcggactgctagtgtcgcggcgtccctaaaaaaccttgcc
tttggaggttcattaacagagccgcaatcgccgcaactttcagcctctgataagagtcgc
atgcccatgacgccacgaggacgagcccctccggaatggacccggccccccgaatttctc
acccatattcagtatttccgggagccccagatgaaacccaatgagcccgatgaacccggt
agcgcggactacaacgaacgcctttggagaagaagccgtaacgaaaggatcatcacagag
acgcagcccctcaagagtaaagctggcagcagccgatgggatacttcaatagccctactc
tctaacagcagccagcccatgaagatgtgctttcaccagttcgaggatcatatcgccgtt
gcggatgacaaagatactattgcgatctgggactggcaaagccacaaacgtctcaatcgg
ttttctaacggaaatccaccagggtcaaagatcaacgaagtccgttacattaacgaagat
gatcaagcacttttattgacaggttcttctgatggagttttgaagattttcaggaattac
gagtccgcacgggatgtcgagatcgtgacggcttttagagctctgccagagcttattcct
agtaaccgaaacgctgggcttgttctcgactggcaacagggccagggtaaggcgctagtc
gcaggagatgtgaaagtcatacgagtatggaatgctgcaactgaagtttgcaccaatgac
atccctgctcgctcaggatcgtgcatcacttccctaacttccgatcaagttgcgggtaac
atcttcgtagctggattcggtgatggggcagtcagagtattcgatcaacgcatcaagccc
acgacttccatggtcaaagtatggcgcgagcacaaacagtggattaccaatgtccacatg
caacggggtggcctaagagagctggtgtctggtagtcggaacggtgagattcgactttgg
gatcttcggatggataatccaatttcgacgctgtacgccactaaagataccttgcgaacg
ttgagcgttcatgaacacgctccagtattcatggtcggcaccaaccgccatgaagtcaag
acattcaacgttgacggcacctttctgtcgacgttcgagccttactcgagtttcctccat
cacaaccgctcttctccgatcgcaagcaccgcattccatcctcaccgcacggttctcgcc
tgtgctgctcttaatgataatcatatcaatctggtttcctgctag

DBGET integrated database retrieval system