KEGG   Aspergillus flavus: AFLA_133610Help
Entry
AFLA_133610       CDS       T01090                                 

Definition
(RefSeq) TORC1 growth control complex subunit Kog1, putative
  KO
K07204  regulatory associated protein of mTOR
Organism
afv  Aspergillus flavus
Pathway
afv04136  Autophagy - other
afv04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:afv00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    AFLA_133610
   04136 Autophagy - other eukaryotes
    AFLA_133610
Membrane trafficking [BR:afv04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    AFLA_133610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Raptor_N WD40 Atx10homo_assoc
Motif
Other DBs
NCBI-GeneID: 7910986
NCBI-ProteinID: XP_002379375
UniProt: B8NFT2
AA seq 1394 aa AA seqDB search
MKDPNLIMEQKATMEPQETSGHAEPRKNTTKSVRVAFGPDLETHIPPRDKSPAPGPGHHR
SFTTVERRHPPVTTPDRPTSSSAGEGPAVIDDNPRLTSDRASDSARPSTLKRAKSDYGPR
LGFEKSPGEDEEDFAMRHGWQEEYTSSEYLKILHSNFYMYFTEKRHETNGMPRDPVGSWP
SQDWRMKDRLKTVSAALAICLNIGVDPPDVVKTNPTAKLECWVDPTSTTGGGQTKIMEQI
GKKLQEQYETLSLRTRYKQYLDPSVDETKKFCISLRRNAKDERVLFHYNGHGVPLPTQSG
EIWVFNKNYTQYIPVSLYDLQSWLAGPSLFVFDVSHAGNIVQNFHTFVEKHEKENIEAKK
RDPNVITQNYGDCIILAACQKSESLPTNPDLPADLFTCCLTTPIEIALRYFILQNPLQSN
ISIDDFRVPGRLQDRRSPLGELNWIFTAITDTIAWNTLPRALFKKLFRQDLMVAALFRNF
LLSERIMRTYKCHPISSPELPETHHHPLWKSWDLAVEMVLAQLPALIDHEEGRRQYEYQH
STFFAEQLTAFEVYLSSGPTEKTPPDQLPIVLQVLLSQAHRLRALILLSKFLDLGPWAVH
LALSIGIFPYVVKLLQSAAQELKPVMVFIWARIMAVDHTVQNDLLKDNGIHYFISILNPS
SPIPVGNASEHRAMCAFIVSIFCKNYPQGQNVCLSAELFDSCLRHLMDVENPLLRQWSCL
CISMLWSDFPEAKWMGIRCAAPARLCELNFDPVPEVRAAMLHAVTTFLGIPDLTDQVAQI
EESLAMAVLPMASDGSVLVRKELLVFFSTFVRRYQNKFLVAAYDELQDEKQSLLSKVEQA
TPRGHSFEDAPNGSANGSLSSYKTQKLSRNSTFGTIWKQLLILSVDPHPDIAQDAATIVD
YIHLSLVQSPMASLTEKIRQEIMDLSNSLSQKTQIRERLESKKTAPPPAPPSVAPPKQEG
YLSLSLKRTASVAASLKNLAFGGSLTEPQSPQLSASDKSRMPMTPRGRAPPEWTRPPEFL
THIQYFREPQMKPNEPDEPGSADYNERLWRRSRNERIITETQPLKSKAGSSRWDTSIALL
SNSSQPMKMCFHQFEDHIAVADDKDTIAIWDWQSHKRLNRFSNGNPPGSKINEVRYINED
DQALLLTGSSDGVLKIFRNYESARDVEIVTAFRALPELIPSNRNAGLVLDWQQGQGKALV
AGDVKVIRVWNAATEVCTNDIPARSGSCITSLTSDQVAGNIFVAGFGDGAVRVFDQRIKP
TTSMVKVWREHKQWITNVHMQRGGLRELVSGSRNGEIRLWDLRMDNPISTLYATKDTLRT
LSVHEHAPVFMVGTNRHEVKTFNVDGTFLSTFEPYSSFLHHNRSSPIASTAFHPHRTVLA
CAALNDNHINLVSC
NT seq 4185 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatcccaatttgattatggaacagaaagccactatggagccccaagaaaccagc
ggtcatgctgaaccccgaaagaacaccaccaaatccgtccgcgtggccttcggtccggac
ctggaaacgcatatccctcctcgcgataagtcacccgcgcctgggccaggacaccacaga
tcgtttactaccgtggagcggagacacccccctgtaaccacccctgacagaccgacgagt
tcctcggcaggtgaaggcccagccgtcatagatgataaccctcggttaacatctgatcgg
gcatcggattcagcacggccgtcgacattgaagcgggctaaaagcgactatggaccaaga
ctggggtttgaaaagtctcctggagaggatgaagaggactttgccatgcgccatggatgg
caggaagagtacacttcgagcgaataccttaaaatcttacactcgaatttttacatgtat
ttcacggaaaaacgccatgagacaaacggcatgccgagagatcccgtgggaagctggccc
agccaggactggcgtatgaaggaccgtttgaaaaccgtttctgcggccttggctatatgc
ttgaacatcggtgttgatcccccggatgtggtcaagacgaaccctacggctaagctcgaa
tgctgggttgacccaacatcgactactgggggcgggcagaccaagatcatggagcagatt
ggaaaaaagctacaggaacaatatgaaacacttagcctaagaactaggtacaagcagtat
ctcgacccatctgttgatgagacgaaaaagttttgcatatctctacgtcgtaacgccaaa
gacgagagagttcttttccattataacggccatggtgtccctttacccacccagtctggt
gaaatatgggtcttcaacaaaaattatactcagtacatcccggtgtccttgtatgatttg
cagtcctggcttgcaggccccagccttttcgtttttgacgtatcacatgctgggaatatt
gtccagaattttcacacctttgtcgagaaacatgaaaaagagaatatcgaagcaaagaag
cgggaccctaatgtgatcacccaaaactatggggattgcataatcctcgccgcgtgccag
aagagcgagtcgcttccaaccaaccctgacctccccgcagatcttttcacttgttgtttg
acgacgcccatcgagatcgctctgagatacttcatcctccagaatcctctgcagagtaac
atctccattgatgatttccgagtcccgggtcgtttgcaggaccgcaggagcccccttgga
gaactaaactggattttcactgctattacggacacgatcgcgtggaataccttgccccga
gctctctttaagaagctcttccgtcaagatttaatggtagcggccctttttagaaatttc
ctccttagcgaacggatcatgcgcacatacaagtgccatccaatatcgtcacctgaactg
ccagagacacaccatcatcctctgtggaaaagctgggatctagccgttgaaatggttttg
gctcagcttcctgcgctcattgatcatgaagaaggtcgtagacaatatgaataccaacac
tctacctttttcgctgagcagcttactgcttttgaggtgtacttgtcatctggacccaca
gagaaaaccccgccggatcagctacctattgtcctgcaagtccttttgagtcaggctcac
cgattgagggccctgattttactcagtaagttcctggacttgggaccctgggccgtccat
ctggctttgagcataggtatcttcccttacgtcgtcaagctcctacagtcggcagctcag
gagctgaagcctgttatggttttcatatgggcaagaatcatggcggtggaccatacagtc
cagaatgatctgctgaaggacaacggaatccactacttcatttctattctcaacccgtca
tcacccatacccgtcggaaacgctagcgaacatcgggccatgtgtgcattcattgtgtcg
atattttgcaaaaattatccccaaggccagaatgtgtgtctctcagcagaactctttgac
tcttgcttgaggcatctgatggatgttgagaatcctttactgcgccaatggtcatgtctt
tgcattagcatgctttggtctgatttccctgaggcaaagtggatggggattcgatgcgcg
gcacctgcaagactctgcgagctcaattttgatcctgtcccggaggtccgagccgcaatg
ttacatgccgtgacgacattcttgggtatccccgatttgacagatcaagtggcacagatc
gaagaatccttagccatggccgtgttaccaatggcatccgatggtagtgtactcgttcga
aaagaacttctggtattcttctcgactttcgtgagacgctatcaaaacaagttcctagtt
gccgcatatgacgagcttcaggatgagaagcagagccttctctccaaagtcgagcaagcg
acacctagaggtcattcctttgaggatgcaccgaatggctccgcaaatggctcgctttcg
agctacaagacacagaagctctctcgtaattctacttttggcaccatttggaaacagctc
cttatcctgtctgttgacccacatcctgacatcgcacaggatgcagctacaattgttgat
tacattcatttgtcccttgtgcaatcccccatggcatcgctaactgaaaaaattcggcaa
gaaataatggacctctcaaacagcttgtcacagaagacgcagatccgggaaagactagag
tcgaagaagactgcaccaccgccggctcctccgtcggttgctccaccaaaacaggaaggc
tatctttctctgagtttaaagcggactgctagtgtcgcggcgtccctaaaaaaccttgcc
tttggaggttcattaacagagccgcaatcgccgcaactttcagcctctgataagagtcgc
atgcccatgacgccacgaggacgagcccctccggaatggacccggccccccgaatttctc
acccatattcagtatttccgggagccccagatgaaacccaatgagcccgatgaacccggt
agcgcggactacaacgaacgcctttggagaagaagccgtaacgaaaggatcatcacagag
acgcagcccctcaagagtaaagctggcagcagccgatgggatacttcaatagccctactc
tctaacagcagccagcccatgaagatgtgctttcaccagttcgaggatcatatcgccgtt
gcggatgacaaagatactattgcgatctgggactggcaaagccacaaacgtctcaatcgg
ttttctaacggaaatccaccagggtcaaagatcaacgaagtccgttacattaacgaagat
gatcaagcacttttattgacaggttcttctgatggagttttgaagattttcaggaattac
gagtccgcacgggatgtcgagatcgtgacggcttttagagctctgccagagcttattcct
agtaaccgaaacgctgggcttgttctcgactggcaacagggccagggtaaggcgctagtc
gcaggagatgtgaaagtcatacgagtatggaatgctgcaactgaagtttgcaccaatgac
atccctgctcgctcaggatcgtgcatcacttccctaacttccgatcaagttgcgggtaac
atcttcgtagctggattcggtgatggggcagtcagagtattcgatcaacgcatcaagccc
acgacttccatggtcaaagtatggcgcgagcacaaacagtggattaccaatgtccacatg
caacggggtggcctaagagagctggtgtctggtagtcggaacggtgagattcgactttgg
gatcttcggatggataatccaatttcgacgctgtacgccactaaagataccttgcgaacg
ttgagcgttcatgaacacgctccagtattcatggtcggcaccaaccgccatgaagtcaag
acattcaacgttgacggcacctttctgtcgacgttcgagccttactcgagtttcctccat
cacaaccgctcttctccgatcgcaagcaccgcattccatcctcaccgcacggttctcgcc
tgtgctgctcttaatgataatcatatcaatctggtttcctgctag

DBGET integrated database retrieval system