KEGG   Aspergillus flavus: AFLA_133950Help
Entry
AFLA_133950       CDS       T01090                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
afv  Aspergillus flavus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AFLA_133950
   01230 Biosynthesis of amino acids
    AFLA_133950
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFLA_133950
   00051 Fructose and mannose metabolism
    AFLA_133950
   00562 Inositol phosphate metabolism
    AFLA_133950
Enzymes [BR:afv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AFLA_133950
Exosome [BR:afv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AFLA_133950
  Exosomal proteins of bladder cancer cells
   AFLA_133950
  Exosomal proteins of melanoma cells
   AFLA_133950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 285 aa AA seqDB search
MASAEQTYPVLPSTLLIISLKMYFTPTRTLDYLRALLDPKNDIVRPENRSKLLLALIPDF
LTIYPSNEIIKNYESSLAPQEAKALPPPFLLGAQDCFWEPLGAYTGEVSPLALRSMGVSI
VELGHAERRSIFGETDDQTGRKAAAASAHGMVPLVCIGEVTAPGPVASQAVGLAVRECEV
QVRAVLKAIPAHAPVIFAYEPVWAIGKPKPAGVDHISAVVDGIKAVIGERPGDVRILYGG
SAGPGLWGAGGLGKAVDGMFLGRFAHEIEGVRKVIREVEETLNVA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgcggagcagacatacccggtgctccccagcaccttactcatcatctccctg
aagatgtacttcacacccacccgaacattagattatctccgcgccctcctcgaccccaaa
aatgacattgtgcggccagagaaccgctccaagctcctgttggccctgatccctgacttc
ctgaccatctaccccagcaacgaaatcatcaaaaactatgaatccagcctagcccctcag
gaagccaaggccctgccgcccccgttcctcctcggcgcccaggactgcttctgggagccg
ctgggcgcatacaccggggaagtatccccactcgctctccgctccatgggcgtgtccatc
gtcgaactgggccacgccgagcgccgctccatcttcggcgaaacagacgaccagacaggt
cgcaaggccgccgcggcctccgcgcacggtatggtgccgctcgtatgcattggcgaggtc
acagcgcctggccccgttgcgtcccaggccgtcggactcgccgtgcgcgagtgcgaggtg
caagtccgcgcagtcctaaaagccatccccgcccatgcccctgtgatcttcgcctatgag
cccgtgtgggcgatcgggaaacccaagcccgctggagtcgatcacatttctgccgtggtg
gacggcatcaaggcggtgattggggagcgtcctggggacgtccgtattttgtatggggga
agtgccgggccgggcctgtggggcgcgggcggtctggggaaagccgttgacggcatgttc
ctggggagattcgcccatgagatcgagggtgtgcggaaggtgatcagggaagtcgaggag
acgttgaacgttgcttga

DBGET integrated database retrieval system