KEGG   Aspergillus flavus: AFLA_134790Help
Entry
AFLA_134790       CDS       T01090                                 

Definition
(RefSeq) pyruvate dehydrogenase kinase
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
afv  Aspergillus flavus
Brite
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     AFLA_134790
Protein kinases [BR:afv01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   AFLA_134790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3 Crust_neurohorm APH_6_hur
Motif
Other DBs
NCBI-GeneID: 7916825
NCBI-ProteinID: XP_002379492
UniProt: B8NGD9
Position
Unknown
AA seq 321 aa AA seqDB search
MNPSKPLPILSETTQNPSIKEGQYRSSPTSAAAAAARRYFVPSDDQGNWPPELNDYNERF
AKTLQHIKRRHDSVVTTVAQGILEWKRKRQRLQIDSTVQSFLDRFYMSRIGIRMLIGQHI
ALTEQTHVRHPNYVGIICTKTNVREVALEAIDNARFVCEDYYGLFEAPKVQLVCKDDLNF
MYVPGHLSHMLFETLKNSLRAVVETHGADKEAFPVTKVIIAEGKEDITIKVSDEGGGIPR
SSIPLVWTYMYTTVEQTPNLDPDFDKSDFKAPMAGFGYGLPISRLYARYFGGDLKLISME
GYGTDVYLHLNRLSSSSEPLQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaagcaaacccctcccgatcctctcggaaaccactcagaaccctagtatcaag
gaagggcaataccggtcctctcccacctcggctgctgccgccgcggctcgaagatatttt
gtaccttccgatgaccagggcaattggcctccggagttgaatgattataacgaacgcttc
gcgaagactctccagcatattaaacgacgacacgacagcgttgtaaccactgtggctcag
ggtattctggaatggaagcgcaaacgccaaagattacagattgactcgaccgttcagtcc
ttcctcgatcgattttatatgtctcggataggtatacgtatgctaatcggccaacatatc
gctttgacagaacaaacgcacgtccgccatccaaattacgttggtattatctgtacgaag
acaaatgttcgtgaagtcgccctcgaagctattgataatgcccgattcgtgtgtgaagat
tactatggtctgttcgaagctccgaaggtccagcttgtctgcaaagatgacctgaacttc
atgtacgtcccgggccacttgtctcatatgctctttgaaaccctcaagaactcccttcgt
gcagtggtagagacccatggtgcagacaaggaagctttcccagtcaccaaagtcatcatt
gccgaaggaaaagaagacatcactatcaaggtgtccgacgagggtggtggaattccccgt
tcttctatccccttggtttggacgtacatgtacactacggtcgagcaaacacccaatttg
gatcccgattttgacaaaagcgacttcaaagcccctatggccggcttcgggtatggatta
cctatcagtcgtttgtatgctcggtacttcggtggggacttgaaattaatcagcatggaa
ggatatggtacggatgtttatcttcatttgaaccgactttcctcgagctcggagcccctg
caatga

DBGET integrated database retrieval system