KEGG   Aspergillus flavus: AFLA_134790Help
Entry
AFLA_134790       CDS       T01090                                 

Definition
pyruvate dehydrogenase kinase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
afv  Aspergillus flavus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 321 aa AA seqDB search
MNPSKPLPILSETTQNPSIKEGQYRSSPTSAAAAAARRYFVPSDDQGNWPPELNDYNERF
AKTLQHIKRRHDSVVTTVAQGILEWKRKRQRLQIDSTVQSFLDRFYMSRIGIRMLIGQHI
ALTEQTHVRHPNYVGIICTKTNVREVALEAIDNARFVCEDYYGLFEAPKVQLVCKDDLNF
MYVPGHLSHMLFETLKNSLRAVVETHGADKEAFPVTKVIIAEGKEDITIKVSDEGGGIPR
SSIPLVWTYMYTTVEQTPNLDPDFDKSDFKAPMAGFGYGLPISRLYARYFGGDLKLISME
GYGTDVYLHLNRLSSSSEPLQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaagcaaacccctcccgatcctctcggaaaccactcagaaccctagtatcaag
gaagggcaataccggtcctctcccacctcggctgctgccgccgcggctcgaagatatttt
gtaccttccgatgaccagggcaattggcctccggagttgaatgattataacgaacgcttc
gcgaagactctccagcatattaaacgacgacacgacagcgttgtaaccactgtggctcag
ggtattctggaatggaagcgcaaacgccaaagattacagattgactcgaccgttcagtcc
ttcctcgatcgattttatatgtctcggataggtatacgtatgctaatcggccaacatatc
gctttgacagaacaaacgcacgtccgccatccaaattacgttggtattatctgtacgaag
acaaatgttcgtgaagtcgccctcgaagctattgataatgcccgattcgtgtgtgaagat
tactatggtctgttcgaagctccgaaggtccagcttgtctgcaaagatgacctgaacttc
atgtacgtcccgggccacttgtctcatatgctctttgaaaccctcaagaactcccttcgt
gcagtggtagagacccatggtgcagacaaggaagctttcccagtcaccaaagtcatcatt
gccgaaggaaaagaagacatcactatcaaggtgtccgacgagggtggtggaattccccgt
tcttctatccccttggtttggacgtacatgtacactacggtcgagcaaacacccaatttg
gatcccgattttgacaaaagcgacttcaaagcccctatggccggcttcgggtatggatta
cctatcagtcgtttgtatgctcggtacttcggtggggacttgaaattaatcagcatggaa
ggatatggtacggatgtttatcttcatttgaaccgactttcctcgagctcggagcccctg
caatga

DBGET integrated database retrieval system