KEGG   Aspergillus flavus: AFLA_134880Help
Entry
AFLA_134880       CDS       T01090                                 

Definition
histone acetyltransferase type b catalytic subunit, putative
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
afv  Aspergillus flavus
Brite
Enzymes [BR:afv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AFLA_134880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 511 aa AA seqDB search
MASEGDWTCDANDAVQITLVQPGEQKPKTLSSFHPQFTYPIFGDDETIFGYKGLIIRLRF
AAHDLRPHIHISYDEKFKTVGDTSAVDLIKTLSPFIPEEAFSTLPDYENAVQEDKDAKDF
VPPGKLVHNYVTRGRTYEIWAASLADPQVRRLLDRAQVFVSLFIEAGTPLETEDPEWTLE
RWTVYFVYEKVKPPTPTASQYSIVGYATTYRWWFYQRDSPEKGTVTNDPFPGPEIRPAQL
PARLRIAQFLILPPHQGSGHGTHLYTTIHTACFNDSTIVELTVEDPNEAFDALRDTADFH
ILRPEFLKHNVNINPDPYAELSKKQRPRRVPTSALIPTKLLHDIRSTYKIASTQFAHVLE
MFLLGEIPTKNRHAGGANMSRLLVKKYNATDPNERRYYWWRMLVKQRLFKRSRDILIQLE
MSDRIEKLEETVTNVEEGYEALIKVFTAREEALMAKQEESGESPETAVLEDSVAGSSDSS
TRDQRTKRKFTVEDEDEEEEGESEVSKRPKV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgaaggcgactggacctgcgacgctaatgacgccgtccagatcactcttgtc
cagcctggtgaacaaaaaccgaagacgctctctagcttccatccacagtttacttaccca
atttttggtgatgacgaaacaattttcggttacaagggattgatcatccgcttgcgattc
gctgctcatgaccttcgtccgcatatccatatttcctacgatgaaaagtttaagaccgtg
ggcgacacctcagcagttgacttgatcaaaacattaagcccattcattccggaagaggct
ttctccacccttccagattatgaaaacgccgtccaagaagacaaagatgcaaaggacttt
gtaccgccaggaaagctcgtccataactatgtcactcgaggacgaacatacgagatctgg
gcggcatctcttgctgatcctcaggtgcgacggctgttggaccgagctcaggtcttcgtg
tcactattcattgaggctggtacaccattagaaacggaggatcccgaatggacacttgag
cgctggacggtctacttcgtgtacgagaaagtgaaacccccaactcccactgcttcacaa
tattccatcgtcggatatgcgacaacctatcgctggtggttctaccaaagggattcccca
gagaaaggcacggtcacgaatgacccattcccaggtcccgaaatacggcctgcacagcta
ccagcccgactgcggattgcccagttcctgattcttcctcctcaccaaggctcgggacat
ggtacccatctgtatacgaccattcataccgcttgcttcaatgattcgacaattgtcgag
ttgacagtcgaagaccctaatgaagcgtttgacgcgctccgcgacaccgcagatttccac
atcctgcgcccagaattccttaaacacaacgtgaatatcaaccccgacccctacgcagaa
ctttctaagaaacagcgaccccgtcgcgtcccaacatctgccctcattcccacaaagctt
ctccacgatatccgttccacctataagattgcctcaacacagtttgctcatgtcttggag
atgtttctcttgggcgagattcccaccaagaatcgtcatgctggtggcgcaaatatgtca
cgtctattggtaaagaaatataatgccacggacccaaacgagcggcggtactactggtgg
cgcatgctagttaaacaacgtctcttcaagcggtctcgtgatattctcatccagctagag
atgagcgaccgcatcgagaaacttgaggagacagtgaccaacgtggaggaaggatacgaa
gcattaatcaaagtctttactgccagagaggaggctctaatggctaagcaagaagaatct
ggcgaatcgcccgaaactgcagtcctagaagactcagtcgcaggttccagtgattcatcg
accagagatcagcgcactaaaagaaagtttacagtagaggatgaggatgaggaggaagag
ggtgaatcggaagtttctaagcgtccgaaggtgtaa

DBGET integrated database retrieval system