KEGG   Aspergillus flavus: AFLA_135040Help
Entry
AFLA_135040       CDS       T01090                                 

Definition
cAMP-dependent protein kinase catalytic subunit PkaC1
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
afv  Aspergillus flavus
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:afv00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    AFLA_135040
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     AFLA_135040
Protein kinases [BR:afv01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   AFLA_135040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 385 aa AA seqDB search
MQSAVTQSPPAHHHHGHHHTNSHNVASIQNIIHSSHQSGQSVGGGSQQSQTRTTKGKYSL
EDFSLQRTLGTGSFGRVHLVQSKHNHRFYAVKVLKKAQVVKMKQIEHTNDERRMLNRVRH
PFLITLWGTWQDSRNLYMVMDFVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSH
QIIYRDLKPENLLLDRHGHLKITDFGFAKEVPDITWTLCGTPDYLAPEVVSSKGYNKSVD
WWSLGILIFEMLCGFTPFWDSGSPVKIYENILRGRVKYPPYLHPDAVDLLSQLITADLTK
RLGNLHGGPEDVKNHPWFAEVTWDRLARKDIDAPYVPPIRGGQGDASQYDRYPEEQEAYG
QSGEDMYVQPARYIFFRITDDPNLL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccgccgtgacgcaatctcccccggcccaccatcaccatggtcaccaccacacc
aactcccataatgtcgccagtatacagaacataattcattcatcccatcagagcggccag
tcggtcggcggaggttctcaacaatcgcagacccgaaccaccaagggcaagtactctctc
gaggatttcagcctccagcgcacattgggcaccggtagctttggtcgagtccatctcgtg
cagtccaagcacaaccaccgcttctatgccgtcaaagttctgaagaaggcccaggtggtc
aagatgaagcagattgagcatactaatgacgagcgacgaatgctcaatcgcgtcaggcat
ccgttcttgatcaccctatggggcacatggcaggattcgcgaaatctgtacatggtcatg
gattttgttgagggaggtgaactcttcagtctgcttcgcaagtctcagcgattccctaac
cccgtggccaagttctacgccgcggaagtcactcttgcgctggagtatctgcactctcat
cagattatctatcgagatctgaagccggagaacttacttctcgaccggcatggccacctg
aagatcaccgactttggttttgcgaaggaggtgcccgatatcacctggaccctgtgtggc
acgcccgattatttggctcccgaggttgtttcatccaagggttacaacaagtcggtggac
tggtggtcccttggaatcctgatcttcgaaatgctgtgtggcttcacacccttctgggac
agcggatcgccggtcaagatctatgagaacatcctccggggtcgggtaaaatacccacct
tacctgcacccagatgctgtggatctactttcccaactgatcacagcagacctaaccaag
cgcctgggcaacttgcatggtggtccggaagacgtcaagaatcatccgtggttcgccgaa
gtcacctgggaccggctggccaggaaagacatcgatgctccctatgtaccaccgattcgg
ggaggacaaggcgatgcaagccagtatgaccgctacccggaagaacaggaagcctacggt
caaagtggcgaggacatgtatgtgcaacctgctcggtatattttcttccgcattactgac
gatcccaacttactttag

DBGET integrated database retrieval system