KEGG   Aspergillus flavus: AFLA_135040Help
Entry
AFLA_135040       CDS       T01090                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit PkaC1
Organism
afv  Aspergillus flavus
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 385 aa AA seqDB search
MQSAVTQSPPAHHHHGHHHTNSHNVASIQNIIHSSHQSGQSVGGGSQQSQTRTTKGKYSL
EDFSLQRTLGTGSFGRVHLVQSKHNHRFYAVKVLKKAQVVKMKQIEHTNDERRMLNRVRH
PFLITLWGTWQDSRNLYMVMDFVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSH
QIIYRDLKPENLLLDRHGHLKITDFGFAKEVPDITWTLCGTPDYLAPEVVSSKGYNKSVD
WWSLGILIFEMLCGFTPFWDSGSPVKIYENILRGRVKYPPYLHPDAVDLLSQLITADLTK
RLGNLHGGPEDVKNHPWFAEVTWDRLARKDIDAPYVPPIRGGQGDASQYDRYPEEQEAYG
QSGEDMYVQPARYIFFRITDDPNLL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccgccgtgacgcaatctcccccggcccaccatcaccatggtcaccaccacacc
aactcccataatgtcgccagtatacagaacataattcattcatcccatcagagcggccag
tcggtcggcggaggttctcaacaatcgcagacccgaaccaccaagggcaagtactctctc
gaggatttcagcctccagcgcacattgggcaccggtagctttggtcgagtccatctcgtg
cagtccaagcacaaccaccgcttctatgccgtcaaagttctgaagaaggcccaggtggtc
aagatgaagcagattgagcatactaatgacgagcgacgaatgctcaatcgcgtcaggcat
ccgttcttgatcaccctatggggcacatggcaggattcgcgaaatctgtacatggtcatg
gattttgttgagggaggtgaactcttcagtctgcttcgcaagtctcagcgattccctaac
cccgtggccaagttctacgccgcggaagtcactcttgcgctggagtatctgcactctcat
cagattatctatcgagatctgaagccggagaacttacttctcgaccggcatggccacctg
aagatcaccgactttggttttgcgaaggaggtgcccgatatcacctggaccctgtgtggc
acgcccgattatttggctcccgaggttgtttcatccaagggttacaacaagtcggtggac
tggtggtcccttggaatcctgatcttcgaaatgctgtgtggcttcacacccttctgggac
agcggatcgccggtcaagatctatgagaacatcctccggggtcgggtaaaatacccacct
tacctgcacccagatgctgtggatctactttcccaactgatcacagcagacctaaccaag
cgcctgggcaacttgcatggtggtccggaagacgtcaagaatcatccgtggttcgccgaa
gtcacctgggaccggctggccaggaaagacatcgatgctccctatgtaccaccgattcgg
ggaggacaaggcgatgcaagccagtatgaccgctacccggaagaacaggaagcctacggt
caaagtggcgaggacatgtatgtgcaacctgctcggtatattttcttccgcattactgac
gatcccaacttactttag

DBGET integrated database retrieval system