KEGG   Aspergillus flavus: AFLA_135670Help
Entry
AFLA_135670       CDS       T01090                                 

Definition
translocation protein Sec62, putative
Orthology
K12275  
translocation protein SEC62
Organism
afv  Aspergillus flavus
Pathway
Protein export
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:afv00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    AFLA_135670
   04141 Protein processing in endoplasmic reticulum
    AFLA_135670
Secretion system [BR:afv02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   AFLA_135670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 401 aa AA seqDB search
MAAPGQPSPQQIAAMQQQFAAEAARRGMTPEEFAKQQREQLNAEAAKHGMSTEQYVQQLR
MRALAAHQKQVEAQRQGQGSPQPGQPGQPGQQGQQDEQGQQTPQQPQPQQTTHQVPVNPS
NPPDPKAIAVAQFLRSQNLKPRTCIMDGQRKDMFKVKRAIRALESPAYAKAAAKKNSLLP
PVTDRASAENVFKLLPLSLLALRVSKVDPHAGHNHAKPKNRVKGLWTVKIEQHQETDPMM
HYVWLYEGPQWKQKAMAAAVVAGIFAVVLFPLWPMVMRQGVWYLSVGMMGLLGLFFAMSI
FRLILFCVTVFAVPPGLWLFPNLFEDVGFIDSFKPLWGWQESKKKKKSKKSSGDASKSAK
SPVSQPADSAPSATTTATAAPDTSSAVKRDLAPRVEEVTDE
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccggccagccgtctccccagcagattgccgccatgcagcaacagttcgct
gctgaggccgcaaggcgtggtatgactccggaggaattcgctaaacaacagcgcgaacag
ctgaatgctgaagctgcgaagcatggcatgtccacggagcaatacgtccaacaactgaga
atgcgagctctcgctgctcaccagaagcaggtcgaggcccaacgacagggccaaggatcg
ccacagccaggacagccaggacaaccaggccagcaaggccagcaagacgagcaaggccag
cagacaccacaacagcctcaaccacaacagactacgcatcaagtccctgtgaacccatcg
aatcccccagaccctaaagccatcgcggttgcgcagttcttgcgatctcagaacctgaag
ccgagaacgtgtatcatggatggacagaggaaggacatgttcaaagtgaaacgtgccatt
cgcgctctggagtcgcccgcgtacgctaaagcagccgcaaagaagaactctttactccct
cccgtaacggaccgtgcatcagcagagaatgttttcaagctcctccccctatcgcttctt
gccttgcgcgtgtcgaaagtcgatccccacgcgggtcacaaccacgcgaagcccaagaac
cgagtcaaggggctgtggaccgtcaagattgagcaacaccaggaaacagaccctatgatg
cactacgtatggctatatgagggtccgcaatggaaacagaaggctatggccgccgcagtg
gtggctggtattttcgccgttgttctcttcccattgtggcccatggtgatgagacagggt
gtttggtacctgagtgttggtatgatgggtctactggggttattcttcgccatgtcgatc
ttccgtcttattctgttttgcgtcacggtctttgctgtccctcctggtctctggttgttc
ccgaacttgttcgaggatgttggcttcattgacagcttcaagcccttgtggggttggcaa
gagagtaagaaaaagaagaagtctaagaagtcttccggcgacgcatccaagtccgccaag
tctcccgtctctcaaccagccgactctgccccttcagcgaccacaacggcaaccgcggcc
ccggatacttcaagtgccgtgaagcgcgatctggcccctcgagttgaggaggtgacagac
gagtaa

DBGET integrated database retrieval system