KEGG   Aspergillus flavus: AFLA_136570Help
Entry
AFLA_136570       CDS       T01090                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
afv  Aspergillus flavus
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AFLA_136570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 112 aa AA seqDB search
MGKDAGFAPGDSAKGAKLFQTRCAQCHTVEKDGANKVGPKLHGLFGRQTGSVDGYAYTDA
NKQAGVTWDENTLYSYLENPKKYIPGTKMAFGGLKKAKERNDLITYLKESTA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggacgctggtttcgctcctggtgactctgccaagggtgccaagctcttccag
actcgctgcgctcagtgccacactgtcgagaaggacggtgccaacaaggtcggccccaag
ctccacggtctctttggccgtcagaccggttccgttgatggctatgcctacaccgatgcc
aacaagcaggccggtgtcacttgggatgagaacactctgtactcctacctcgagaacccc
aagaagtacatccccggtaccaagatggccttcggtggtctcaagaaggctaaggagagg
aacgacctcatcacttacctcaaggagagcactgcttaa

DBGET integrated database retrieval system