KEGG   Aspergillus flavus: AFLA_137910Help
Entry
AFLA_137910       CDS       T01090                                 

Definition
hypothetical protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
afv  Aspergillus flavus
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:afv00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:afv00740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 350 aa AA seqDB search
MKGLLFVLSAIFGITLAAPATCTPERALVRKEWRELEYAERKDYIDALWCLRDRPSILPS
EEFPGVRDRWDDFVATHINYTNNIHFNGLLLPWHRQFVYLWEVALREECGYKGSVPYWNW
ALDTENLAESPLFDGSSTSLSGNGAYVPNEPMPCTPGGICFPRGTGGGCVESGPFKDLQV
HLGPFNSSLAQSYGSLPVNAWNYNPRCLYRSLNQALLVALNNQARIDQMQTSTNIRDWLA
IMSPSNPDLTSSHGGGHGAVGGAMADFFASPQDPSFMLHHAFIDKLWAEWQDQDPETRRY
AVNGTTVIYDPPGAPVVTLDTMVEFGELCHPRKVEKIMHPLRNGYCYTYT
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggctactattcgttctctcggcgatcttcggtattaccctagctgcaccggca
acatgcactccggagagagccttggtaaggaaagaatggagagagctggagtatgctgaa
cggaaggactatattgatgcgctatggtgcctacgcgatcgcccgtctatcctacccagc
gaagaatttcccggggttcgtgaccgttgggatgattttgttgcgactcatatcaactac
acgaacaacatccatttcaacggacttctccttccatggcaccgccagttcgtgtatctc
tgggaagtggcccttcgagaggaatgtgggtacaaaggcagcgtaccgtattggaactgg
gccctcgacaccgaaaacctagccgagagcccattattcgatggcagttccacctccctc
tccggcaacggcgcatacgtaccgaatgagccgatgccctgtacacccggagggatatgc
ttcccccgaggaacaggcggaggctgcgttgagtcaggaccattcaaagaccttcaagtt
cacttgggaccattcaattcctctctagctcagtcctacggttctctccccgtcaacgca
tggaactacaatccgcgttgtctatacaggagcctgaaccaagctttgctcgtggcgctg
aacaatcaagcccgaattgatcaaatgcaaacatcgaccaacatcagagactggctcgca
atcatgtccccaagtaaccctgatttaacgagttcacatggcggcggccatggggctgtg
ggaggtgccatggccgatttcttcgcgtcgcctcaggatccctcgtttatgttgcaccac
gcttttattgataaattgtgggcggaatggcaggatcaggatccggagactaggcgatat
gctgttaatggtactactgttatctatgatccgccgggtgctccggtggtgacgctggat
actatggttgagtttggggagctgtgtcatcctcgcaaggttgagaagattatgcatccg
ttgaggaatggttattgttatacttacacttga

DBGET integrated database retrieval system