KEGG   Aspergillus flavus: AFLA_137980Help
Entry
AFLA_137980       CDS       T01090                                 

Definition
NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
afv  Aspergillus flavus
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:afv00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 292 aa AA seqDB search
MSAFASENLTSALLVVGTAIFAVLVGAKFLGGSGKPRKVLNPTEFQNFVLKEKNEISHNV
AIYRFALPRPTDILGLPIGQHISLAATIEGQPKEVVRSYTPISSDNEAGYFDLLVKAYPQ
GNISKYLTTLKIGDNMKVRGPKGAMVYTPNMCRHIGMIAGGTGITPMLQIIKAIIRNRPR
NGGNDTTQVDLIFANVNPEDILLKEELEQLVKEDDGFRVYYVLNNPPEGWTGGVGFVTPD
MIKERLPAPAQDIKIMLCGPPPMISAMKKATESLGYTKARPVSKLEDQVFCF
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcctttgcttcggagaacttgacctccgccctcctggtggttggcacagccatt
ttcgctgtcttggtcggcgcgaagtttctcggtggtagtggtaaacccagaaaggtcctg
aaccctaccgagttccagaactttgtcttgaaggagaagaatgagatctctcacaacgtc
gctatctatcgctttgccctgcctcgccccaccgacatcttgggtctgcccatcggtcaa
cacatctctctcgccgctaccattgaaggccagcccaaggaggttgtgcgctcttacacc
cccatctcctccgacaatgaggctggatactttgatctcctcgtcaaggcctaccctcag
ggtaacatctccaagtacctgaccaccctgaagatcggcgacaacatgaaggtgcgcggc
cccaagggtgccatggtgtacaccccgaacatgtgccgtcacattggtatgatcgccgga
ggaaccggtatcacccccatgctgcagatcatcaaggccatcatccgcaaccgcccccgc
aacggtggtaatgacaccacccaggtggacctgatctttgccaacgtcaaccccgaggat
atcctgctgaaggaagaactggagcagctcgtcaaggaggatgacggcttccgtgtctac
tatgtgcttaacaacccccctgagggctggaccggtggtgttggattcgttactcctgac
atgatcaaggagcgcctccctgctccggcccaggacatcaagatcatgctgtgcggcccc
cctcccatgatcagcgccatgaagaaggcgaccgagtctcttggatacaccaaggctcgc
cctgtcagcaagctcgaggaccaggtgttctgcttctaa

DBGET integrated database retrieval system