KEGG   Aspergillus flavus: AFLA_138180Help
Entry
AFLA_138180       CDS       T01090                                 

Definition
lysozyme, putative
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
afv  Aspergillus flavus
Brite
Enzymes [BR:afv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     AFLA_138180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 183 aa AA seqDB search
MSSSLKFLGVLLPALAVACTGPPVNQNGLNLIKSFESFQPSVYDDGFGNPTIGYGHLCGD
ATCSEVTYPKPLSEADASRLLADDLVSYQDALTNALADPVTLNDNQYAALVSWTFNIGNG
NMQKSDLVARMNKGENVATVAHDELPQWNKANGQVVNGLTRRRKAELDLFDAPAIYGALP
VPC
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcctcgctcaagttcctgggtgtccttctccccgcccttgctgttgcctgcaca
ggccctcctgtcaaccaaaacggtcttaacttgattaagagctttgagtcattccagccc
agcgtttacgacgatggcttcggcaacccgaccattggttatggtcacctctgtggcgat
gcgacctgctccgaagtgacctaccctaagccattgtccgaggcagatgccagcagacta
ctggctgatgacttggtttcctaccaagacgccctcaccaatgccctagcggacccagtc
accttaaatgataaccaatacgctgctcttgtgtcttggacattcaacatcggaaatggc
aacatgcaaaaatcggaccttgtggcccgcatgaacaagggtgaaaatgtggcgacggtt
gcgcatgacgaactgccgcaatggaataaggccaacgggcaagtcgtcaatgggcttact
cgtcgccgcaaggctgagttggaccttttcgatgcaccggctatctatggtgctttgcct
gttccttgctga

DBGET integrated database retrieval system