KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_0127Help
Entry
Anae109_0127      CDS       T00559                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:afw00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(153628..154545)
Genome map
AA seq 305 aa AA seqDB search
MRLQTIAPAKVNLVLRVGPPRRDGYHGIRSLMVPLDLGDRVDVSVGERAGPVTCRVPGRP
ELDGADNLAARAAERFRARFGVERTIGIRIAKRIPVTAGLGGGSSDAAAVLRCLARAFGI
RDRAALAAIALEVGSDVPFFLGPGPAWAEGRGERLTPADVPPQHLVLVYPDDPALAIRAG
EAYRWLDASRQGRRPRLPPRFARFEPSRAGNDLQPPCLLERPPLATLLGLLVGRGATAAI
MSGSGPTVFGTFHSRNAAARAARTIAEEVVDRKVMVLAATTVRRHPGVTPWRSPRSASSP
STKRS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcctccagacgatcgccccggccaaggtgaacctcgtgctgcgcgtcggcccgccg
cgcagggacggctatcacggcatccgctcgctgatggtccccctcgacctcggcgatcgc
gtggacgtgtcggtgggcgagcgcgccggccccgtcacctgccgggtcccggggaggccg
gagctcgacggcgccgacaacctcgccgcgcgcgccgccgagcgcttccgcgcgcgcttc
ggcgtcgagcggacgatcggcatccggatcgcgaagcgcatcccggtgaccgcggggctc
ggcggcgggtcctccgacgccgcggcggtgctgcgctgcctcgctcgcgcgttcgggatc
cgcgaccgcgccgcgctcgccgcgatcgccctcgaggtcggctccgacgtgcccttcttc
ctcggcccggggccggcgtgggccgagggccggggcgagaggctcacgcccgccgacgtg
cccccgcagcacctcgtcctcgtctaccccgacgatccggcgctcgcgatccgggccggc
gaggcctaccgctggctcgacgcgtcgcggcagggccgcaggccgcgtctgccgccgcgc
ttcgcgcgcttcgagccatcccgcgcggggaacgatctccagccgccctgcctgctggag
cggccgcccctggcgacgctcttggggctgcttgtgggtcgaggcgcgacggccgctata
atgtcgggaagtgggcccaccgtgttcggcacgtttcacagccggaacgcggctgcgcgg
gcggcgcggacgatcgcggaggaggtcgtcgatcggaaggtgatggtcctcgccgcgacg
acggtgcgacggcatccgggggttacgccatggagatcaccgaggtccgcgtcttccccg
tcaacgaagagaagctga

DBGET integrated database retrieval system