KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_0166Help
Entry
Anae109_0166      CDS       T00559                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anae109_0166
   00030 Pentose phosphate pathway
    Anae109_0166
   00051 Fructose and mannose metabolism
    Anae109_0166
   00052 Galactose metabolism
    Anae109_0166
   00500 Starch and sucrose metabolism
    Anae109_0166
   00520 Amino sugar and nucleotide sugar metabolism
    Anae109_0166
  Nucleotide metabolism
   00230 Purine metabolism
    Anae109_0166
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Anae109_0166
Enzymes [BR:afw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Anae109_0166
    5.4.2.8  phosphomannomutase
     Anae109_0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
193102..194472
Genome map
AA seq 456 aa AA seqDB search
MDTLSPTIFREYDIRGLVDQDLTEHAVHLVGKALGTRIREAGGRKAAVGRDARLSGERFR
DAMVSALTSTGIDVLDLGVVPTPLTYFAAHTAGVDGICMITGSHNPPEYNGLKVGLGAAT
FHGEEIQALRRLAESGRFASGSGTVSPYDVITPYRKYVRENLRLGGRKLKVVVDAGNGTG
GVIAVPILEALGVEVVPLFIDMDGRFPNHHPDPTVEKNLEHLKAKVLETKADLGIAYDGD
ADRVGAVDERGRVLWGDQIMILFSRALLAEEPGAAIVGEVKCSMSLYDDIAKRGGRAIMW
KAGHSLIKAKMKEERALLAGEMSGHIFFAHRWFGFDDGIYSSARLVELLSRTDAPLSALL
ADVPRTESTPELRVDCPEDKKFEVVRRAQEFFAARYEAVTVDGVRVVFPDGWGLVRASNT
QPLLVLRFEARTKERLDEIEALVRGKVAEIMREVGA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggacacgctctcgcccacgatcttccgtgagtacgacatccgcgggctcgtcgatcag
gacctgacggagcacgcggtccacctcgtgggcaaggcgctcgggacgcgcatccgcgag
gcgggcgggcgcaaggcggccgtcggccgcgacgcgcgcctctccggcgagcgcttccgc
gacgcgatggtctcggcgctcacctcgaccgggatcgacgtgctggatctcggcgtggtg
ccgaccccgctcacctacttcgcggcgcacaccgcgggcgtggacggcatctgcatgatc
accggctcccacaacccgccggagtacaacggcctcaaggtggggctcggcgcggcgacc
ttccacggcgaggagatccaggcgctgcgacggctcgccgagtccgggcggttcgcgagc
gggtccggcacggtgagcccgtacgacgtgatcaccccctaccggaagtacgtccgggag
aacctccgcctcggcggccgcaagctgaaggtggtggtggacgccgggaacgggaccggc
ggcgtgatcgccgtgcccatcctcgaggcgctcggggtcgaggtggtgccgctgttcatc
gacatggacggccgcttcccgaaccaccacccggatccgaccgtggagaagaacctcgag
cacctgaaggcgaaggtgctggagacgaaggcggacctcggcatcgcctacgacggcgac
gcggatcgcgtgggcgcggtggacgagcgggggcgggtgctgtggggggatcagatcatg
atcctcttctcgcgcgcgctcctcgccgaggagcccggcgccgccatcgtcggcgaggtg
aagtgctcgatgtcgctctacgacgacatcgcgaagcgcggcggacgcgccatcatgtgg
aaggccgggcacagcctcatcaaggccaagatgaaggaggagcgcgcgctgctcgccggc
gagatgagcgggcacatcttcttcgcccaccgctggttcgggttcgacgacgggatctac
tcgtcggcgcgcctcgtggagctgctctcccggacggacgcgccgctctcggccctgctc
gccgacgtcccccggaccgagtccacgccggagctgcgggtcgactgcccggaggacaag
aagttcgaggtggtgcgccgcgcccaggagttcttcgccgcgcgctacgaggcggtgacg
gtggacggcgtgcgcgtcgtcttcccggacggctgggggctcgtgcgggcctcgaacacc
cagccgctgctcgtgctgcgcttcgaggcgcgcacgaaggagcggctcgacgagatcgag
gcgctcgtgcgcggcaaggtcgccgagatcatgcgggaggtgggggcctag

DBGET integrated database retrieval system