KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_0167Help
Entry
Anae109_0167      CDS       T00559                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Anae109_0167
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anae109_0167
   00052 Galactose metabolism
    Anae109_0167
   00500 Starch and sucrose metabolism
    Anae109_0167
   00520 Amino sugar and nucleotide sugar metabolism
    Anae109_0167
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Anae109_0167
   00524 Butirosin and neomycin biosynthesis
    Anae109_0167
Enzymes [BR:afw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Anae109_0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
194475..195434
Genome map
AA seq 319 aa AA seqDB search
MPLGIGVDLGGTNARAAVVDADTGEIVAAHKEPLRDRTPAGVVEIVRHAIGEATSAASVV
PGVFGAVGVGVAGQCLGRTGVVLNAPNLGWRDIAFGELLRDALGVPVRVANDLSVAAWGE
KRFGAAKGIDDVVLVFVGSGVGSGLILDGRLYDGAQGVAGEFGHVKVTPLRAETAVRRCG
CGDWGCLEAYTSGVNVATRVREELAAGARTAIFERVGGDLARVTASLVDDAYRAGDAYAR
ALWAEVGELLGTAIANLVTVLNPARLILGGGVLLGCPALGELVRRTFDAKVSKSAGKGLS
IEHAWLGDDAGVIGAAVLP
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcgggatcggcgtggacctgggggggacgaacgcgcgcgccgcggtcgtggac
gccgacacgggcgagatcgtcgccgcgcacaaggagccgctgcgggaccgcaccccggcg
ggcgtggtcgagatcgtgcgccacgccatcggggaggccacctccgcggcgagcgtggtc
ccgggtgtcttcggggcggtgggggtgggcgtcgcagggcagtgcctggggcgcaccggg
gtcgtgctgaacgcgccgaacctggggtggcgcgacatcgccttcggggagctgctccgc
gacgcgctcggcgtgcccgtgcgggtcgcgaacgacctgtcggtcgcggcctggggcgag
aagcgcttcggcgcggcgaaggggatcgacgacgtggtgctcgtgttcgtcggctccggc
gtcggctcgggcctcatcctggacggccggctgtacgacggcgcgcagggcgtcgcgggg
gagttcggccacgtgaaggtcacgccgctgcgcgccgagacggcggtgcgtcgctgcggc
tgcggtgactggggctgcctcgaggcctacacctcgggggtgaacgtggcgacgcgcgtg
cgcgaggagctcgccgccggcgcgcgcaccgccatcttcgagcgggtgggtggagacctc
gcgcgcgtgaccgcgagcctggtggacgacgcttaccgggcgggcgacgcctacgcccgg
gcgctctgggcggaggtgggcgagctgctcggcaccgccatcgcgaacctcgtcaccgtg
ctcaaccccgcccggctcatcctgggcggcggcgtgctgctcggctgccccgccctcggg
gagctcgtgcgccggaccttcgacgcgaaggtctccaagtccgcggggaaggggctcagc
atcgagcacgcgtggctgggagacgatgcgggcgtgatcggcgccgccgtgttgccctag

DBGET integrated database retrieval system