KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_0244Help
Entry
Anae109_0244      CDS       T00559                                 

Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Anae109_0244
Enzymes [BR:afw01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Anae109_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
282133..284076
Genome map
AA seq 647 aa AA seqDB search
MSSSKSVSKPLAIAAVLVAAAAVAVRCAPREPKGARREAAKSDVSVAAQKTYVAPGDLDE
YYMFSSGGHSGQVFIYGLPSMRHLATIPVFAPYPATGYGFDDETKEMLGKLTWGDVHHPA
LSETKGDYDGRWLFVNEMNGRIARIDLRDFKTRQIIGPVPNVSGNHGSAFVTPNTEYAMM
SSRFSIPIPKGTAVSIDKYASEYKGIVAGIKIDPESGKMSLGWQVALPPFDWDLGDAGKL
VSDGWMFLTCYNSERGTGKLEVTASQRDRDYIAAINWREAEKAAAEGKGDLIGGVKVLDP
RKVPGLVYLMPCGKSPHGVDVSPDGKYIIGSGKLQGVTTAFNFEKVLTAIKNKDFTGEED
GIPVLKYESIKDAEVPVGLGPLHTQFGPDGWAYTSLFVDSALAKWKLGTWEVVDKVPMSY
STGHLSAAEGDTVSPDGKWLVGLNKLSHGRHLSVGPSQPESSQLVDISEDKMKLVYDAFT
EPEPHYAQIIKADKVKPIEVYKKEENKNPLAVWDVKDTGASRKGNEVVVKMTAVRSTFTP
QLIEVNQGDTVKVAVTNIEQTTDELHGFGLLDYNINLVVDPGETKVVTFKADKPGVFPYY
CTNFCSALHQEMQGYLVVRPARAAAPAEGDEGGGARAGREETRRGPR
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctcgaagagcgtctcgaagccactcgcgatcgccgcggtcctggtcgcggcg
gccgcggtcgcggtgcgctgtgcgcccagggagccgaagggagcgaggcgggaggccgcc
aagtcggacgtctcggtcgcggcgcagaagacgtacgtcgccccgggggatctcgacgag
tactacatgttctcctccggcggtcactccggtcaggtgttcatctatggcctcccgtcg
atgcgccacctcgcgaccatcccggtgttcgcgccgtaccccgccacgggctacggcttc
gacgacgagacgaaggagatgctcgggaagctcacctggggcgacgtgcaccacccggcg
ctctccgagaccaagggcgactacgacggccgctggctgttcgtgaacgagatgaacggc
cggatcgcgcgcatcgatctgcgcgacttcaagacgcggcagatcatcgggccggtcccg
aacgtctccgggaaccacggctcggcgttcgtcacccccaacaccgagtacgccatgatg
tcctcccggttctcgatccccatccccaaggggacggccgtctcgatcgacaagtacgcg
agcgagtacaagggcatcgtcgcagggatcaagatcgacccggagtccgggaagatgtcg
ctcggctggcaggtggcgctcccgccgttcgactgggatctgggcgacgccggcaagctc
gtctccgacgggtggatgttcctcacctgctacaactccgagcgcggcaccggcaagctc
gaggtcaccgcgtcgcagcgcgaccgggactacatcgcggcgatcaactggcgcgaggcg
gagaaggccgctgccgaggggaagggcgacctcatcggcggggtgaaggtgctcgacccg
cgcaaggtgcccgggctcgtgtacctcatgccctgcgggaagtcgccgcacggcgtggac
gtctcgccggacggcaagtacatcatcggctcagggaagctgcagggcgtcaccaccgcc
ttcaacttcgagaaggtcctcaccgcgatcaagaacaaggacttcaccggcgaggaggac
ggcatcccggtcctcaagtacgagtcgatcaaggacgccgaggtgccggtggggctcggg
ccccttcacacgcagttcggcccggacggctgggcgtacacctcgctcttcgtcgacagc
gcgctcgcgaagtggaagctcgggacctgggaggtcgtggacaaggtccccatgtcgtac
tcgaccggccacctctccgccgccgagggtgacaccgtgtcgcccgacgggaagtggctc
gtgggcctgaacaagctctcccacgggcgccacctgtcggtggggccgtcgcagcccgag
tcctcgcagctggtggacatctccgaggacaagatgaagctcgtgtacgacgccttcacc
gagccggagccgcactacgcgcagatcatcaaggcggacaaggtgaagccgatcgaggtc
tacaagaaggaggagaacaagaacccgctcgcggtgtgggacgtgaaggacacgggcgcg
agccgcaagggaaacgaggtggtggtgaagatgaccgcggtgcgctccaccttcacgccg
cagctcatcgaggtgaaccagggcgacacggtgaaggtggcggtgacgaacatcgagcag
acgacggacgagctgcacggcttcgggctgctcgactacaacatcaacctcgtcgtcgat
cccggcgagacgaaggtcgtcacgttcaaggccgacaagccgggcgtgttcccctactac
tgcacgaacttctgctccgcgctccaccaggagatgcagggctacctcgtggtccggccc
gcgcgtgccgcggcgccggccgaaggcgacgagggcggtggcgcgcgggccggccgggag
gagaccaggaggggaccgcgatga

DBGET integrated database retrieval system