KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_0318Help
Entry
Anae109_0318      CDS       T00559                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Anae109_0318
Enzymes [BR:afw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Anae109_0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(369380..370960)
Genome map
AA seq 526 aa AA seqDB search
MPRQAGVLLPLFSLRSARDWGVGEIPDLVPFGRWCAGAGFSIVQVLPVNEASRGQHSPYA
ALSAFAIDPVYLALGGLEDFEAAGGEEALSSEDRERLARVRAAPSVRWNEVRALKRRALE
LAFARFERDEWSRGTARARALEAFARAEAAWLDDYALFVAIHDDALGGRAWMDWPEQLRE
RAPEALAEARARHSRTILFYTWLQWQLEEQWHAARRAANEAGVELAGDLPFMVATDSADV
WARRGDFRLDARVGVPPDAFSATGQDWGLPVYRWDAMEREGYPWLRERARRMADLYGLYR
VDHVVGLYRTYFFPNDGSPPAFVPEGEEAQTKNGERVLGLFSAGARVTAEDLGTVPDFVR
ESLRRIEVPGYCVLRWERHWHVPDQPFRDPRTWPALSVATTGTHDTDSLADWWDGMPDDE
RAALLALPGLAGLRAREKAFYDDAVRDALLELVYAAGSELLLLPFQDAFGLRDRVNVPGT
VTAENWTYRMPRHLGALAADLGARDRLRDLAARSGRLVGSTGGERG
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgccccgacaggccggcgtcctcctcccgctcttctcgctccgctcggcccgcgactgg
ggcgtcggcgagatccccgacctcgtcccgttcggccgctggtgcgccggggcgggcttc
tccatcgtgcaggtgctgccggtgaacgaggcgtcgcgcgggcagcacagcccttacgcc
gcgctgtcggccttcgccatcgatccggtctacctcgcgctcggcgggctcgaggacttc
gaggcggcgggcggagaggaggcgctctcctccgaggaccgcgagcggctcgcgcgggtg
cgcgccgcgccgtcggtgcgctggaacgaggtccgtgcgctgaagcgccgcgccctggag
ctcgccttcgcgcgcttcgagcgcgacgagtggtcccgcgggaccgcgcgggcccgggcg
ctcgaggcgttcgcgcgcgcggaggccgcctggctcgacgactacgcgctcttcgtcgcg
atccacgacgacgccctcggcggccgcgcctggatggactggcccgagcagctgcgcgag
cgcgccccggaggcgctcgccgaggcccgcgcgcgccactcccgcacgatcctcttctac
acctggctccagtggcagctcgaggagcagtggcacgccgcgcggcgcgcggcgaacgag
gccggcgtggagctcgccggcgacctgcccttcatggtggcgaccgactccgccgacgtc
tgggcgcggcgaggcgacttccggctcgacgcgcgcgtgggcgtcccccccgacgcgttc
agcgcgaccggccaggactggggtctgcccgtgtaccgctgggacgcgatggagcgcgag
ggctacccctggctgcgggagcgcgcgcgccgcatggcggacctgtacggcctgtaccgg
gtggaccacgtggtcgggctgtaccgcacctacttcttcccgaacgacggcagcccgccg
gcgttcgtgcccgagggcgaggaggcgcagacgaagaacggcgagcgcgtcctcggcctc
ttctccgccggcgcgcgcgtcacggcggaggacctcggcaccgtcccggacttcgtgcgc
gagtcgctccggcgcatcgaggtccccggctactgcgtcctccgctgggagcgccactgg
cacgttccggaccagccgttccgcgaccctcgcacctggccggccctctcggtcgccacg
acgggcacgcacgacaccgactcgctggcggactggtgggacgggatgccggacgacgag
cgcgcggcgctcctcgccctgcccgggctggccggcctgcgcgcgcgcgagaaggccttc
tacgacgacgccgtgcgcgacgcgctgctcgagctcgtctacgcggcgggctcggagctc
ctcctcctgccgttccaggacgccttcgggctgcgcgaccgcgtgaacgtgccggggacg
gtgaccgccgagaactggacgtaccggatgccgcgccacctcggcgcgctcgcggccgac
ctgggcgcgcgcgaccggctgcgcgacctcgccgcgcggagcgggcggctcgtggggagc
accggtggcgagcgcggctga

DBGET integrated database retrieval system