KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_0328Help
Entry
Anae109_0328      CDS       T00559                                 

Definition
leucyl aminopeptidase
Orthology
K01255  
leucyl aminopeptidase [EC:3.4.11.1]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Glutathione metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Anae109_0328
Enzymes [BR:afw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     Anae109_0328
Peptidases [BR:afw01002]
 Metallo Peptidases
  Family M17: leucyl aminopeptidase family
   Anae109_0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(379274..380866)
Genome map
AA seq 530 aa AA seqDB search
MARKQATAKARTGKATARKQPSVKAAGTPAIELAADALALPVYEEDVRAGGRGRVKALDA
LLGGALAAAVKAERFAGKAGQELSLPTLGRAPAGRVLLLGMGPRGKAEAWPSTGFEPLRH
AAGKAARAAAKAGARALAVALPEDGVEDVAGAARALAEGALLGAYAFERYKSEDDARRTP
LAELTVAVPAGAERRAELRDALELAREIGAAVAWARDLVNLGPADCTPTLLAEQAEALAR
EARLAVEVRGPKEIAALGMGMFLGVTRGSSEPARLVTLSWIPRGAAAKKPPVVLVGKAIT
FDSGGLSLKPTESMVTMNTDMAGSAAVLGAMRVVARLAPPFPVHAVLGACENMPGGKAYK
PSDVLVSYAGKTVEITNTDAEGRLVLGDVLAWAAQTWNPALMVDVATLTGACMVALGHTT
AGLFGPDGAAVDGLLAAAGASGEELWRLPMTESLKEQLKSDRADLKNTGERWGGAIAAAH
FLHAFVKDVPWAHLDIAGPSHAPKERGYVAKGGTGFGVRTLVELVRAHRP
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtaagcaggcgacggcgaaggcccgcacgggcaaggccacggcgaggaagcag
ccctcggtgaaggcggcggggacccccgcgatcgagctcgctgcggacgcgctcgcgctg
ccggtctacgaggaggacgtccgggccggcgggcgcggtcgggtgaaggccctcgacgcg
ctgctcggcggcgccctggcggcggccgtgaaggcggagcgcttcgcggggaaggccggc
caggagctctcgctcccgacgctggggcgcgcgcccgcgggccgggtgctcctgctcggc
atgggccctcgcggcaaggcggaggcgtggccgtcgacgggcttcgagccgctccgccac
gcggccggcaaggccgcgcgcgccgcggccaaggcgggcgcgcgcgcgctcgccgtcgcc
ctccccgaggacggcgtcgaggacgtcgccggggcggcgcgggcgctcgccgagggcgcg
ctcctcggcgcctacgccttcgagcgctacaagagcgaggacgacgcgcggcggaccccg
ctcgccgagctcaccgtggcggtgcccgccggcgcggagcggcgggccgagctgagggac
gcgctcgagctcgcgcgcgagatcggcgccgccgtggcctgggcgcgggacctcgtcaac
ctggggcctgccgactgcacccccaccctcctcgcggagcaggccgaggccctcgcgcgc
gaggcgcggctcgccgtcgaggtgcggggcccgaaggagatcgcggcgctcggcatgggc
atgttcctcggcgtgacccgcggctcctccgagccggcccggctcgtcaccctgagctgg
atcccgaggggcgccgcggcgaagaagccgccggtcgtgctcgtcggcaaggccatcacc
ttcgactcgggtggcctgtcgctgaagcccaccgagagcatggtgaccatgaacaccgac
atggccggctcggcggccgtcctcggcgcgatgcgcgtcgtcgcccgcctcgcgccgccg
ttcccggtgcacgcggtcctgggcgcctgcgagaacatgcccggcggcaaggcctacaag
ccctccgacgtgctcgtctcctacgcgggcaagaccgtcgagatcaccaacaccgacgcg
gagggccggctcgtgctcggggacgtgctggcctgggccgcgcagacgtggaacccggcg
ctgatggtcgacgtggcgacgctcaccggcgcctgcatggtggccctcggccacaccacc
gccggcctcttcggcccggacggcgcggcggtggacggcctgctcgccgcggcgggcgcc
tccggcgaggagctctggcggctgcccatgaccgagtcgctgaaggagcagctgaagagc
gatcgcgccgatctgaagaacaccggggagcgctggggcggggccatcgccgccgcgcac
ttcctccacgcgttcgtgaaggacgtcccctgggcgcacctcgacatcgcgggcccctcc
cacgccccgaaggagcgcggctacgtcgcgaagggcgggacgggcttcggcgtgcgcacg
ctcgtcgagctcgtgcgcgcccaccggccgtga

DBGET integrated database retrieval system