KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_0357Help
Entry
Anae109_0357      CDS       T00559                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:afw00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
412497..412988
Genome map
AA seq 163 aa AA seqDB search
MRAYVGVGTNLGDRWGHLAHAAKALRAEPRIALLRGSRVFDTAPMGPAQPRYLNAVLELE
VDLPAGALLEALQRVERRCGRRRKGVRWAARTLDLDLLLLDDEVVRTPALVLPHPGILTR
RFVLAPLAELCPDRIVPGTGCTVARLLGDAPAADVVPVGIYPL
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcctacgtgggcgtcggcacgaacctcggtgatcgctgggggcacctcgcgcac
gcggcgaaggcgctccgggccgagccgcggatcgcgctgctgcgcgggtcgcgcgtcttc
gacaccgcgccgatgggccccgcgcagccgcgctacctgaacgccgtcctcgagctcgag
gtggacctgccggccggagcgctgctcgaggcgctccagcgcgtggagcgtcgctgcggc
cggcggcgcaaaggcgtccgctgggcagcgcgcacgctcgacctcgacctcctgctcctc
gacgacgaggtggtccgcacgcccgcgctggtcctgccgcacccggggatcctgacccgc
aggttcgtgctcgccccgctcgccgagctgtgcccggaccgtatcgtcccgggcaccggg
tgcaccgtcgcgcggctcctcggggacgcccccgcggcggacgtggtgcccgtggggatc
tacccgctgtga

DBGET integrated database retrieval system