KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_0362Help
Entry
Anae109_0362      CDS       T00559                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:afw00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(416051..416776)
Genome map
AA seq 241 aa AA seqDB search
MSPRRRAALSSRRTKARGSPRAARVPAVSGERALRDAIVETCRRLHARDLIGAGEGNVSA
RLGEDRFLVTPSGANKGYLAPADLVVVDGRGAVVSGEGRASTELRMHLAAYAARADVAAV
VHAHPITAVALTVAGLPPPNDLVPEAAVTLGEIAVAPFATPGTDEVPGSLAPLWAGHDVV
LLERHGALALGRSLGEAFDRMETLERVARVALVARLAGRCEPLSAEAIAKVLAAAGKPAR
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccccgccgccgcgccgccctctcctcccgccgcacgaaggcgcgcggctcgccg
cgggccgcccgcgtccccgccgtctccggtgagcgcgcgctccgcgatgcgatcgtggag
acctgccgccgcctgcacgcccgcgacctcatcggcgccggcgagggcaacgtctccgcc
cgcctcggggaggaccgcttcctcgtcaccccctccggcgcgaacaagggctacctcgcc
ccggccgacctcgtcgtggtggacgggcgcggcgcggtggtctccggagaaggccgcgcc
tccaccgagctgcgcatgcacctcgccgcctacgctgcgagggcggacgtcgcggcggtc
gtgcacgcccacccgatcaccgcggtggcgctcaccgtcgcggggctcccgcccccgaac
gacctcgtgccggaggcggcggtcacgctgggtgagatcgccgtcgcgccgttcgcgacg
cccggcaccgacgaggtgcccggctcgctcgcgccgctctgggcgggccacgacgtcgtg
ctgctggagcgccacggggccctcgcgctgggccgctcgctcggcgaggcgttcgaccgg
atggagacgctcgagcgcgtggcgcgtgtggccctcgtggcccggctcgccgggcggtgc
gagccgctctccgcggaggcgatcgcgaaggtgctcgccgcggcggggaagccggcgcgc
ggctag

DBGET integrated database retrieval system