KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_0370Help
Entry
Anae109_0370      CDS       T00559                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:afw01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:afw00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:afw00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(422820..423662)
Genome map
AA seq 280 aa AA seqDB search
MKTAKASAPAAAAPPTDRIAAAFARCRARGEAALVTYVMGGDPDLATSRAMALACVEGGA
DLLELGVPFSDPMADGPTIQHAAERALASGTTPDGVLEVAAAVRARSDVPIALMGYLNPI
LARGVDRFAQGCARAGVDAVIVPDLLPEEAGDVAPVLAARGIRTVFLLAPTSDAARVEAA
ARAATGFLYFVSVTGVTGARRAVAAEIAPAVAAIRAKSPVPVVIGFGVSSPAQARELGPL
ADGVVVGSAIVQRVAEGGSRAARGARVTRFVRSLKRALRR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaagacggcgaaggccagcgcaccggccgcggcggcgcccccgaccgatcggatcgcg
gcggcgttcgcgcgctgccgggcccggggcgaggcggcgctcgtgacgtacgtgatgggc
ggcgatcccgacctcgccacctcgcgggcgatggcgctcgcctgcgtcgagggcggcgcc
gacctgctcgagctcggcgtccccttctccgatcccatggcggacggccccaccatccag
cacgccgcggagcgcgcgctcgcgtcgggcacgacgccggacggcgtgctcgaggtggcc
gcggcggtgcgcgcgcgctcggacgtgcccatcgcgctcatgggctacctgaacccgatc
ctcgcccgcggcgtcgaccggttcgcccagggctgcgctcgcgccggggtggacgcggtg
atcgtccccgatctcctccccgaggaggccggcgacgtggcccccgtcctcgccgcgcgc
gggatccgcaccgtgttcctgctcgcgcccacctccgacgcggcccgcgtcgaggccgcg
gcccgcgccgccaccgggttcctctacttcgtctccgtgaccggagtgaccggcgcccgg
cgggcggtcgcggcggagatcgcgccggcggtcgccgccatccgcgcgaagagcccggtg
ccggtggtgatcggcttcggcgtttcctcgcccgcgcaggcgcgcgagctgggaccgctc
gcggacggggtggtggtcgggagcgccatcgtgcagcgcgtcgccgagggcggctcccgc
gcggcgcgcggcgcgcgcgtcacccgcttcgtgcgctcgctcaagcgggcgcttcggcgc
tga

DBGET integrated database retrieval system