KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_0470Help
Entry
Anae109_0470      CDS       T00559                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:afw00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Anae109_0470
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Anae109_0470
Enzymes [BR:afw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Anae109_0470
Two-component system [BR:afw02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Anae109_0470
Bacterial motility proteins [BR:afw02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Anae109_0470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
531860..532927
Genome map
AA seq 355 aa AA seqDB search
MIRCLLVDDSRSFRALLRALLERAGIDVVGEAADGDAAVAKAVALRPDVVTMDVRMPGKD
GLAAIEEIMRVAPTPVVVVSAEAGPERQELAFWALELGAVEVLAKPRAVDAARFDREVQA
IRDAVRSVAGLKVVTRHRRRALPAAAPRAAPAPPPRGASPAHAPRVLGIAASTGGPAAIA
RILRALPREFPAPILVVQHIAPGFEAGLAHWLGSETRLSVKLAQDGELLRAGTVYVGADG
RHLTARADRVRLVDAPPVRGFRPSGTTLLESLAREYGGAAAGLVLSGMGDDGADGLRSVR
ERGGWTAAQGPASAVVFGMPGAAIERGAALHTLELDDIAPALLRLARAPALAPRA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatccgctgcctgctggtggacgactcgcggtcgttccgcgccctgctgcgcgcgctc
ctcgagcgcgccggcatcgacgtggtcggggaggcggcggacggcgacgccgccgtcgcg
aaggcggtcgccctccgccccgacgtcgtgacgatggacgtgcgcatgcccggaaaggac
gggctcgcagccatcgaggagatcatgcgcgtcgcgccgacgccggtggtggtggtctcc
gcggaggcgggcccggagcggcaggagctcgcgttctgggcgctcgagctcggcgcggtg
gaggtgctcgcgaagccgcgcgcggtggacgccgcgcgcttcgaccgtgaggtccaggcc
atccgcgacgcggtccgctcggtggcggggctcaaggtcgtgactcgccaccgtcggcgc
gcgctgccggcggccgccccgcgagcggcgccggcgccgccgccgcgcggcgcgtccccc
gcccacgcgccccgggtcctcgggatcgccgcctcgaccggcggccctgcggcgatcgcg
cggatcctccgggccttgccgcgcgagttccccgcgcccatcctggtggtgcagcacatc
gccccggggttcgaggcggggctcgcccactggctcgggagcgagacgcgcctctcggtg
aagctcgcgcaggacggcgagctgctgcgcgcgggcacggtctacgtgggcgccgatgga
cggcacctcaccgcgcgcgcggatcgcgtgaggctcgtggacgcccctccggtgcgcggc
ttccggccgtccggcacgacgctgctcgagtcgctggcgcgcgagtacggcggcgcggcg
gccgggctggtcctgtcgggcatgggggacgacggcgccgacggcctcaggtcggtgcgc
gagcgcggcggctggacggcggcgcaggggcctgcctccgcggtggtgttcggcatgccc
ggcgccgcgatcgagcggggcgccgccctccacaccctcgagctcgacgacatcgccccc
gcgctcctcaggctcgctcgcgcccccgccctcgccccccgcgcgtga

DBGET integrated database retrieval system