KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_0561Help
Entry
Anae109_0561      CDS       T00559                                 

Definition
alcohol dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Anae109_0561
  Energy metabolism
   00680 Methane metabolism
    Anae109_0561
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Anae109_0561
Enzymes [BR:afw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Anae109_0561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
640291..641505
Genome map
AA seq 404 aa AA seqDB search
MRAVVWKGPGKVAVEKVEDPRIESATDVLVRITTAGICGSDLHMYEGRTVAEPGVVLGHE
NMGVIEEVGSAVQQLQKGDRVVLPFNVACGTCFNCSRGYTSACLVTNEEGAGAAYGYVGM
GPYRGGQAELLRVPWGEANCIKLPGEPGDELEDDFLLLSDIFPTGYHAAEMAKVQPGSTV
AIFGAGPVGLLAAYSAMLRGAAEVYVVDAIPERLEKAQQIGAIAIDFRQGSPAEQIRDLR
LGNPLVRGSMRRGEEKMAGVMCGIDAVGYQAKDFEDPSKEQPTSLTEQLVEIINPTGALG
IIGVFLPQDPGGKDRAAKRGAYTLPWGKLWEKGIQLGMGQTPVKNYSLVLRDLVVAGRAK
PSFIVSRRIPLSEAPDAYRRFDRREPGYTKVLIKPGEEATAATH
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagtggtgtggaaggggccggggaaggtcgcggtggagaaggtcgaggatccg
cgcatcgagagcgcgaccgacgtgctggtgcgcatcaccaccgccggcatctgcggcagc
gacctgcacatgtacgagggccgcaccgtcgccgagccgggggtggtgctcgggcacgag
aacatgggggtcatcgaggaggtgggcagcgcggtgcagcagctgcagaagggcgatcgc
gtggtcctgcccttcaacgtcgcctgcgggacctgcttcaactgctcgcgcggctacacc
agcgcctgcctggtgacgaacgaggagggggccggggccgcgtacggctacgtggggatg
gggccgtaccggggcggacaggccgagctcttgcgcgtcccgtggggcgaggccaactgc
atcaagctgcccggcgagccgggcgacgagctcgaggacgacttcctgctcctctccgac
atcttccccaccggctaccacgccgccgagatggccaaggtgcagcccggctccacggtg
gcgatcttcggcgccgggcccgtgggcctgctcgccgcgtacagcgcgatgctgcggggc
gccgccgaggtgtacgtcgtcgacgccatccccgagcggctggagaaggcgcagcagatc
ggggcgatcgccatcgacttccggcagggctcgcccgccgagcagatccgcgacctgcgc
ctcgggaacccgctcgtgcgcggctcgatgcgccgcggcgaggagaagatggcgggcgtc
atgtgcggcatcgacgcggtcggctaccaggccaaggacttcgaggatccgagcaaggag
cagccgacctccctcaccgagcagctcgtggagatcatcaaccccaccggcgcgctcggc
atcatcggcgtcttcctcccgcaggatccgggcggcaaggacagggcggcgaagcggggg
gcgtacacgctgccgtggggcaagctgtgggagaagggcatccagctcggcatggggcag
acgccggtgaagaactacagcctcgtgctccgcgatctcgtcgtggccggccgggcgaag
ccgagcttcatcgtctcgcggcgcatcccgctcagcgaggcgccggacgcctaccggcgc
ttcgaccggcgcgagcccgggtacacgaaggtcctcatcaagccgggcgaggaggcgacg
gcggcgacgcactga

DBGET integrated database retrieval system