KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_0830Help
Entry
Anae109_0830      CDS       T00559                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Anae109_0830
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Anae109_0830
  Amino acid metabolism
   00310 Lysine degradation
    Anae109_0830
Enzymes [BR:afw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Anae109_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
939621..940934
Genome map
AA seq 437 aa AA seqDB search
MSIQLKVPSLGESVTQATIGAWLKSEGESVQVDEPLVEVESEKATVAVPAPAAGVLRRVL
KRTGDTVAVGEAIADIEEGAAGASVAVSPLGSGPTPGGLVPAARPESPPPQPTPPAPVAP
EASGPRGAASAPAPTPGGGAAARRAPPSARRLMAEHGLEAGAVAGSGPGGQVRKEDVVRA
LERPAEARAPAPAPQPAARPDGATARERLVAMTSLRRTVARRLVEAQQTAAILTTFNEVD
MSRVLEVRERHGEAFLAKHGVKLGFMSFFVKAAVEALRAFPVVNAEVRGTDIVYKDHYDI
GVAVGGGKGLVVPIVRDADALSFAEVEKRIGELAKKARDNRITMDDLAGGTFTISNGGIY
GSLLSTPILNPPQSGILGLHKIEKRAVVTAGDQIAARPMMYVALSYDHRIVDGREAVQFL
IAVKNAIEDPERILLEI
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccagctgaaggtcccgtctctcggcgagtcggtgacgcaggccaccatcgga
gcgtggctgaagagcgagggcgagagcgtccaggtggacgagccgctcgtggaggtggag
agcgagaaggccacggtggcggtgccggcgcccgcggcgggcgtgctgcggcgggtgctg
aagcgcacgggcgacacggtcgcggtgggcgaggcgatcgccgacatcgaggagggcgcg
gcgggggcgagcgtcgcggtctccccgctcggctcgggcccgacgcccggcggcctcgtg
cccgccgcgcgcccggagtctccgccgccccagcccacgccgccggctcccgtcgcgccc
gaggcctccgggccgcggggcgcggcctccgccccggcgccaaccccgggcggaggggcg
gccgcgcggcgggcgccgccgagcgcgcgccggctcatggccgagcacggcctcgaggca
ggcgcggtcgccgggtccggtcccggcggtcaggtgcgcaaggaggacgtggtccgcgcg
ctggagcggcccgccgaggcgcgcgccccggcgccggcgccccagccggcggcgcggccc
gatggcgcgaccgcgcgcgagcggctggtcgcgatgacctcgctgcgccgcaccgtcgcg
cgccggctcgtcgaggcgcagcagaccgcggccatcctgaccaccttcaacgaggtcgac
atgtcgcgcgtcctcgaggtgcgcgagcggcacggggaggcgttcctcgcgaagcacggc
gtgaagctcgggttcatgtcgttcttcgtgaaggcggcggtcgaggcgctgcgcgcgttc
cccgtggtgaacgccgaggtgcgcggcaccgacatcgtctacaaggatcactacgacatc
ggggtcgccgtgggcggcggcaaggggctcgtcgtgcccatcgtgcgcgacgcggacgcg
ctctccttcgcggaggtcgagaagcggatcggcgagctcgcgaagaaggcccgcgacaac
cgcatcaccatggacgacctcgccggggggaccttcaccatctcgaacggcggcatctac
ggctcgctcctctccacgcccatcctgaacccgccgcagtccgggatcctcggcctccac
aagatcgagaagcgcgcggtggtgacggcgggcgaccagatcgcggcgcggccgatgatg
tacgtcgcgctctcctacgatcaccgcatcgtcgacgggcgcgaggcggtgcagttcctc
atcgcggtgaagaacgcgatcgaggacccggagcggatcctgctcgagatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system