KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_0830Help
Entry
Anae109_0830      CDS       T00559                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00020  Citrate cycle (TCA cycle)
afw00310  Lysine degradation
afw01100  Metabolic pathways
afw01110  Biosynthesis of secondary metabolites
afw01120  Microbial metabolism in diverse environments
afw01130  Biosynthesis of antibiotics
afw01200  Carbon metabolism
Module
afw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
afw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Anae109_0830
  Amino acid metabolism
   00310 Lysine degradation
    Anae109_0830
Enzymes [BR:afw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Anae109_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ABS25041
JGI: Anae1090830
UniProt: A7H8J5
Position
939621..940934
Genome map
AA seq 437 aa AA seqDB search
MSIQLKVPSLGESVTQATIGAWLKSEGESVQVDEPLVEVESEKATVAVPAPAAGVLRRVL
KRTGDTVAVGEAIADIEEGAAGASVAVSPLGSGPTPGGLVPAARPESPPPQPTPPAPVAP
EASGPRGAASAPAPTPGGGAAARRAPPSARRLMAEHGLEAGAVAGSGPGGQVRKEDVVRA
LERPAEARAPAPAPQPAARPDGATARERLVAMTSLRRTVARRLVEAQQTAAILTTFNEVD
MSRVLEVRERHGEAFLAKHGVKLGFMSFFVKAAVEALRAFPVVNAEVRGTDIVYKDHYDI
GVAVGGGKGLVVPIVRDADALSFAEVEKRIGELAKKARDNRITMDDLAGGTFTISNGGIY
GSLLSTPILNPPQSGILGLHKIEKRAVVTAGDQIAARPMMYVALSYDHRIVDGREAVQFL
IAVKNAIEDPERILLEI
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccagctgaaggtcccgtctctcggcgagtcggtgacgcaggccaccatcgga
gcgtggctgaagagcgagggcgagagcgtccaggtggacgagccgctcgtggaggtggag
agcgagaaggccacggtggcggtgccggcgcccgcggcgggcgtgctgcggcgggtgctg
aagcgcacgggcgacacggtcgcggtgggcgaggcgatcgccgacatcgaggagggcgcg
gcgggggcgagcgtcgcggtctccccgctcggctcgggcccgacgcccggcggcctcgtg
cccgccgcgcgcccggagtctccgccgccccagcccacgccgccggctcccgtcgcgccc
gaggcctccgggccgcggggcgcggcctccgccccggcgccaaccccgggcggaggggcg
gccgcgcggcgggcgccgccgagcgcgcgccggctcatggccgagcacggcctcgaggca
ggcgcggtcgccgggtccggtcccggcggtcaggtgcgcaaggaggacgtggtccgcgcg
ctggagcggcccgccgaggcgcgcgccccggcgccggcgccccagccggcggcgcggccc
gatggcgcgaccgcgcgcgagcggctggtcgcgatgacctcgctgcgccgcaccgtcgcg
cgccggctcgtcgaggcgcagcagaccgcggccatcctgaccaccttcaacgaggtcgac
atgtcgcgcgtcctcgaggtgcgcgagcggcacggggaggcgttcctcgcgaagcacggc
gtgaagctcgggttcatgtcgttcttcgtgaaggcggcggtcgaggcgctgcgcgcgttc
cccgtggtgaacgccgaggtgcgcggcaccgacatcgtctacaaggatcactacgacatc
ggggtcgccgtgggcggcggcaaggggctcgtcgtgcccatcgtgcgcgacgcggacgcg
ctctccttcgcggaggtcgagaagcggatcggcgagctcgcgaagaaggcccgcgacaac
cgcatcaccatggacgacctcgccggggggaccttcaccatctcgaacggcggcatctac
ggctcgctcctctccacgcccatcctgaacccgccgcagtccgggatcctcggcctccac
aagatcgagaagcgcgcggtggtgacggcgggcgaccagatcgcggcgcggccgatgatg
tacgtcgcgctctcctacgatcaccgcatcgtcgacgggcgcgaggcggtgcagttcctc
atcgcggtgaagaacgcgatcgaggacccggagcggatcctgctcgagatctga

DBGET integrated database retrieval system