KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_0830Help
Entry
Anae109_0830      CDS       T00559                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Anae109_0830
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Anae109_0830
  Amino acid metabolism
   00310 Lysine degradation
    Anae109_0830
Enzymes [BR:afw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Anae109_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
939621..940934
Genome map
AA seq 437 aa AA seqDB search
MSIQLKVPSLGESVTQATIGAWLKSEGESVQVDEPLVEVESEKATVAVPAPAAGVLRRVL
KRTGDTVAVGEAIADIEEGAAGASVAVSPLGSGPTPGGLVPAARPESPPPQPTPPAPVAP
EASGPRGAASAPAPTPGGGAAARRAPPSARRLMAEHGLEAGAVAGSGPGGQVRKEDVVRA
LERPAEARAPAPAPQPAARPDGATARERLVAMTSLRRTVARRLVEAQQTAAILTTFNEVD
MSRVLEVRERHGEAFLAKHGVKLGFMSFFVKAAVEALRAFPVVNAEVRGTDIVYKDHYDI
GVAVGGGKGLVVPIVRDADALSFAEVEKRIGELAKKARDNRITMDDLAGGTFTISNGGIY
GSLLSTPILNPPQSGILGLHKIEKRAVVTAGDQIAARPMMYVALSYDHRIVDGREAVQFL
IAVKNAIEDPERILLEI
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccagctgaaggtcccgtctctcggcgagtcggtgacgcaggccaccatcgga
gcgtggctgaagagcgagggcgagagcgtccaggtggacgagccgctcgtggaggtggag
agcgagaaggccacggtggcggtgccggcgcccgcggcgggcgtgctgcggcgggtgctg
aagcgcacgggcgacacggtcgcggtgggcgaggcgatcgccgacatcgaggagggcgcg
gcgggggcgagcgtcgcggtctccccgctcggctcgggcccgacgcccggcggcctcgtg
cccgccgcgcgcccggagtctccgccgccccagcccacgccgccggctcccgtcgcgccc
gaggcctccgggccgcggggcgcggcctccgccccggcgccaaccccgggcggaggggcg
gccgcgcggcgggcgccgccgagcgcgcgccggctcatggccgagcacggcctcgaggca
ggcgcggtcgccgggtccggtcccggcggtcaggtgcgcaaggaggacgtggtccgcgcg
ctggagcggcccgccgaggcgcgcgccccggcgccggcgccccagccggcggcgcggccc
gatggcgcgaccgcgcgcgagcggctggtcgcgatgacctcgctgcgccgcaccgtcgcg
cgccggctcgtcgaggcgcagcagaccgcggccatcctgaccaccttcaacgaggtcgac
atgtcgcgcgtcctcgaggtgcgcgagcggcacggggaggcgttcctcgcgaagcacggc
gtgaagctcgggttcatgtcgttcttcgtgaaggcggcggtcgaggcgctgcgcgcgttc
cccgtggtgaacgccgaggtgcgcggcaccgacatcgtctacaaggatcactacgacatc
ggggtcgccgtgggcggcggcaaggggctcgtcgtgcccatcgtgcgcgacgcggacgcg
ctctccttcgcggaggtcgagaagcggatcggcgagctcgcgaagaaggcccgcgacaac
cgcatcaccatggacgacctcgccggggggaccttcaccatctcgaacggcggcatctac
ggctcgctcctctccacgcccatcctgaacccgccgcagtccgggatcctcggcctccac
aagatcgagaagcgcgcggtggtgacggcgggcgaccagatcgcggcgcggccgatgatg
tacgtcgcgctctcctacgatcaccgcatcgtcgacgggcgcgaggcggtgcagttcctc
atcgcggtgaagaacgcgatcgaggacccggagcggatcctgctcgagatctga

DBGET integrated database retrieval system