KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_0830Help
Entry
Anae109_0830      CDS       T00559                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:afw01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:afw00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:afw00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
939621..940934
Genome map
AA seq 437 aa AA seqDB search
MSIQLKVPSLGESVTQATIGAWLKSEGESVQVDEPLVEVESEKATVAVPAPAAGVLRRVL
KRTGDTVAVGEAIADIEEGAAGASVAVSPLGSGPTPGGLVPAARPESPPPQPTPPAPVAP
EASGPRGAASAPAPTPGGGAAARRAPPSARRLMAEHGLEAGAVAGSGPGGQVRKEDVVRA
LERPAEARAPAPAPQPAARPDGATARERLVAMTSLRRTVARRLVEAQQTAAILTTFNEVD
MSRVLEVRERHGEAFLAKHGVKLGFMSFFVKAAVEALRAFPVVNAEVRGTDIVYKDHYDI
GVAVGGGKGLVVPIVRDADALSFAEVEKRIGELAKKARDNRITMDDLAGGTFTISNGGIY
GSLLSTPILNPPQSGILGLHKIEKRAVVTAGDQIAARPMMYVALSYDHRIVDGREAVQFL
IAVKNAIEDPERILLEI
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccagctgaaggtcccgtctctcggcgagtcggtgacgcaggccaccatcgga
gcgtggctgaagagcgagggcgagagcgtccaggtggacgagccgctcgtggaggtggag
agcgagaaggccacggtggcggtgccggcgcccgcggcgggcgtgctgcggcgggtgctg
aagcgcacgggcgacacggtcgcggtgggcgaggcgatcgccgacatcgaggagggcgcg
gcgggggcgagcgtcgcggtctccccgctcggctcgggcccgacgcccggcggcctcgtg
cccgccgcgcgcccggagtctccgccgccccagcccacgccgccggctcccgtcgcgccc
gaggcctccgggccgcggggcgcggcctccgccccggcgccaaccccgggcggaggggcg
gccgcgcggcgggcgccgccgagcgcgcgccggctcatggccgagcacggcctcgaggca
ggcgcggtcgccgggtccggtcccggcggtcaggtgcgcaaggaggacgtggtccgcgcg
ctggagcggcccgccgaggcgcgcgccccggcgccggcgccccagccggcggcgcggccc
gatggcgcgaccgcgcgcgagcggctggtcgcgatgacctcgctgcgccgcaccgtcgcg
cgccggctcgtcgaggcgcagcagaccgcggccatcctgaccaccttcaacgaggtcgac
atgtcgcgcgtcctcgaggtgcgcgagcggcacggggaggcgttcctcgcgaagcacggc
gtgaagctcgggttcatgtcgttcttcgtgaaggcggcggtcgaggcgctgcgcgcgttc
cccgtggtgaacgccgaggtgcgcggcaccgacatcgtctacaaggatcactacgacatc
ggggtcgccgtgggcggcggcaaggggctcgtcgtgcccatcgtgcgcgacgcggacgcg
ctctccttcgcggaggtcgagaagcggatcggcgagctcgcgaagaaggcccgcgacaac
cgcatcaccatggacgacctcgccggggggaccttcaccatctcgaacggcggcatctac
ggctcgctcctctccacgcccatcctgaacccgccgcagtccgggatcctcggcctccac
aagatcgagaagcgcgcggtggtgacggcgggcgaccagatcgcggcgcggccgatgatg
tacgtcgcgctctcctacgatcaccgcatcgtcgacgggcgcgaggcggtgcagttcctc
atcgcggtgaagaacgcgatcgaggacccggagcggatcctgctcgagatctga

DBGET integrated database retrieval system