KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_1275Help
Entry
Anae109_1275      CDS       T00559                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Anae109_1275
Enzymes [BR:afw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Anae109_1275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1443835..1444866)
Genome map
AA seq 343 aa AA seqDB search
MSFDPSAAAQPGSGVFGLPHSEDEAGVVLVPVPFEATTSYGGGTSRGPEAILSASRQVDL
FDVETGRPYEAGIHMLEVPEHVTRLDREARAAAAPVIDAGGVLPGRDDLARAAAAVDAAC
EQVNRWVEERVDGLLARGKRVGLVGGDHSTALGAIAAHARRYPGLGLLHVDAHADLRVAF
EGFTYSHASVIYNAAERCPGISRVVQVGLRDLSEEEHAYAERSGGRIVQHHDARLAQARF
EGEPWAAVVRRILEPLPRDVYVSFDVDGLDPTLCPHTGTPVPGGLSFQEAAALVGGIVRS
GRRLVGFDLVEVAPDPDGGEWDGNVGARLLYKLVGWMLRSQQG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcgatccctccgccgccgcccagccgggctccggcgtcttcggcctgccgcac
tccgaggacgaggcgggcgtcgtcctcgtccccgtcccgttcgaggcgacgacctcctac
ggcggcggcacgagccgcggcccggaggcgatcctgtcggcgagccggcaggtggacctc
ttcgacgtggagaccgggcgtccgtacgaggccggcatccacatgctcgaggtcccagag
cacgtcacgcggctcgatcgggaggcgcgggcggccgcggcgccggtcatcgacgcgggc
ggcgtgttgcccgggcgggacgatctcgcgcgggccgccgcggcggtggacgcggcctgc
gagcaggtgaaccgctgggtcgaggagcgcgtggacgggctgctcgcccgcggcaagcgc
gtcggcctggtgggcggcgatcactcgaccgcgctcggcgccatcgccgcccacgcgcgg
cgctaccccggcctcgggctcctccacgtggacgcccacgcggatctgcgtgtggcgttc
gaggggttcacctacagccacgcgtccgtgatctacaacgccgcggagcggtgccccggg
atctcccgcgtcgtgcaggtggggctgcgggacctctccgaggaggagcacgcctacgcc
gagcgctcgggcgggcgcatcgtgcagcaccacgacgcccggctggcccaggcgcgcttc
gagggagagccctgggcggcggtcgtgcggcgcatcctcgagccgctgccgcgcgacgtg
tacgtctccttcgacgtcgacgggctcgatccgacgctctgcccgcacaccggcacgccg
gtgcccggtggcctctccttccaggaggcggcggcgctcgtcggagggatcgtccggagc
ggccggcgcctcgtcgggttcgacctggtcgaggtggcgcccgatcccgacggcggggag
tgggacggcaacgtcggcgcccggctcctgtacaagctcgtgggctggatgctgcggtcg
cagcagggttga

DBGET integrated database retrieval system