KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_1311Help
Entry
Anae109_1311      CDS       T00559                                 

Definition
(p)ppGpp synthetase I SpoT/RelA
Orthology
K00951  
GTP pyrophosphokinase [EC:2.7.6.5]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Purine metabolism
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:afw00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1482877..1485093
Genome map
AA seq 738 aa AA seqDB search
MPHRGTNRYARTTGLLRLNDILDRVAGYHPGPDLDLIKKAYVYSAKVHQGQIRKSGEPYL
IHPLEVAGLLAELKLDEASVVTGLLHDTIEDTLATKEEIAELFGPEIAELVDGVTKLSQF
SAANTQEEKQAENFRKMVVAMAKDIRVLLVKLADRTHNMRTLDHMKPESQERIARETLDI
YAPLANRLGIQWLKSELEDLSFKYLRPQDYVELSTRVEAEQKEKGEFVEEVVDLIRTRLT
GAGINAQVSGRVKHVYSIWRKMRQLDVDFDQIQDVIGFRVIVDSVAECYESLGIIHSLWK
PVPGRFKDYIAIPKPNLYQSLHTTVVGPRGERIEVQIRTKEMHRIAEEGVAAHWAYKEKG
RDGKGAELSKKDAESFGWLRQLVEWQRELADPREFLETVKVDLFSDEVFVFTPKGAVKSL
PRGATPVDFAYTIHSEVGEHTVGAKVNGKLVPLRYKLKNGDTVEILTSPNAHPSKDWLSF
VKTSRAQARIRQFIRQAEHRRSLEIGRDVAEREFRRFGVALGKVQKGGELEKAAQSLGYR
AADDLLAAIGYGKVAPAEVIRQLVPADKLAETAPTEPSPTSRLTEIFRKVARRPAGGVRI
NGIDDVLVRFGRCCNPVPGDSIVGFITRGRGVTVHTLACDKVMEIVPERRVDVAWDVKGD
FKRQISIRVITSDRPGILAKISQIFSEAGLNISQASCRTTPGERAVNDFEVTVGDLKQLN
SVIRNLERIEGVQSVERV
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcaccggggcacgaaccgatacgctcgcacgaccggcttgctgcgcctcaacgac
atcctggaccgggtcgccggctaccatccgggtcccgacctggacctgatcaagaaggcg
tacgtctactccgccaaggtccaccaggggcagatccggaagtcgggcgagccgtacctc
atccatccgctcgaggtcgcgggcctcctggccgagctcaagctcgacgaggcttcggtc
gtcacggggctcctccacgacaccatcgaggacaccctcgcgacgaaggaggagatcgcg
gagctgttcgggcccgagatcgcggagctggtcgacggcgtcaccaagctctcccagttc
agcgccgcgaacacccaggaggagaagcaggccgagaacttccgcaagatggtcgtggcg
atggcgaaggacatccgcgtcctgctcgtgaagctcgccgatcgcacgcacaacatgcgg
accctggaccacatgaagccggagtcgcaggagcggatcgcgcgcgagacgctcgacatc
tacgccccgctcgcgaaccggctcgggatccagtggctgaagagcgagctcgaggatctc
tcgttcaagtacctgcggccgcaggactacgtcgagctgtcgacgcgcgtcgaggcggag
cagaaggagaagggcgagttcgtcgaggaggtggtcgacctcatccgcacccgcctcacc
ggcgccggcatcaacgcgcaggtctcggggcgcgtgaagcacgtctactcgatctggcgg
aagatgcggcagctcgacgtggacttcgatcagatccaggacgtcatcggcttccgcgtg
atcgtcgactcggtggccgagtgctacgagtcgctcggcatcatccactcgctgtggaag
ccggtgccgggccgcttcaaggactacatcgcgatcccgaagccgaacctgtaccagtcc
ctccacacgaccgtggtcgggccgcgcggcgagcgcatcgaggtgcagatccgcaccaag
gagatgcaccggatcgccgaggagggcgtcgccgcccactgggcgtacaaggagaagggg
cgggacgggaagggcgccgagctctcgaagaaggacgcggagagcttcggctggctgcgg
cagctcgtcgagtggcagcgcgagctcgccgatccgcgcgagttcctggagacggtcaag
gtcgacctcttctccgacgaggtcttcgtcttcacgccgaagggcgcggtgaagagcctg
ccccgcggcgccacgcccgtggacttcgcgtacaccatccactccgaggtgggcgagcac
accgtcggcgcgaaggtgaacggcaagctcgtaccgctccgctacaagctcaagaacggc
gacacggtcgagatcctcacctcgccgaacgcgcacccctcgaaggactggctcagcttc
gtcaagacgagccgggcgcaggcccgcatccggcagttcatccggcaggcggagcaccgc
cgctccctcgagatcgggcgcgacgtggcggagcgcgagttccggcgcttcggcgtggcg
ctcgggaaggtgcagaagggcggcgagctcgagaaggcggcgcagtccctgggctaccgg
gcggcggacgacctcctcgccgccatcggctacggcaaggtcgcgccggcggaggtgatc
cggcagctggtccccgccgacaagctggccgagaccgcgcccaccgagccgtcgccgacc
tcgcggctcaccgagatcttccgcaaggtggcgcgccgcccggcgggcggcgtgcgcatc
aacggcatcgacgacgtgctcgtgcgcttcgggcgctgctgcaacccggtgccgggcgac
tcgatcgtcggcttcatcacccgggggcgaggcgtgaccgtccacacgctggcctgcgac
aaggtcatggagatcgtgccggagcggcgcgtcgacgtcgcgtgggacgtgaagggcgac
ttcaagcgccagatctcgatccgggtcatcacgagcgatcgccccggcatcctcgcgaag
atctcgcagatcttcagcgaggccgggctcaacatctctcaggcgagctgccgcacgacg
cccggcgagcgcgccgtgaacgacttcgaggtgacggtcggagacctgaagcagctcaac
tcggtcatccgcaacctcgagcggatcgagggcgtccagtccgtcgagcgcgtctga

DBGET integrated database retrieval system