KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_1415Help
Entry
Anae109_1415      CDS       T00559                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00860  Porphyrin and chlorophyll metabolism
afw01100  Metabolic pathways
afw01110  Biosynthesis of secondary metabolites
afw01120  Microbial metabolism in diverse environments
Module
afw_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Anae109_1415
Enzymes [BR:afw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Anae109_1415
Exosome [BR:afw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Anae109_1415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABS25622
JGI: Anae1091415
UniProt: A7HA76
Position
1600497..1601522
Genome map
AA seq 341 aa AA seqDB search
MPFPQDRPRRMRRNEVLRSLVRETILAPDDLVWPLFVLPGKRVRNPVKSMPGVFQLSVDE
LVAEAQAGYEAGVRSVILFGIPEHKDEIGSGAYDEDGIVPQAIRALKAQVPGLVVMTDVC
MCEYTDHGHCGILKAPRAGGPGQDLGVDNDATLPLLAKEAVAHAKAGADIVAPSDMMDGR
VAAIRKGLDAEGYGDVPVLSYAAKFAGAFYGPFRDAAESAPREGAGIPKDRKGYQMDPGN
WREALREVALDVAEGADMVMVKPAVPYLDIVRLVRDRFELPVAAYHVSGEYAMIKAAAER
GWIDEARVVLETLLCCRRAGADLVLTYYAKEAAGLLTGKRR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcccttcccccaggaccgcccccgccgcatgcgccgcaacgaggtgctgcgcagcctc
gtccgcgagacgatcctcgcgccggacgacctcgtctggccgctgttcgtcctcccgggc
aagcgcgtgcgcaaccccgtcaagtccatgccgggcgtcttccagctctcggtggacgag
ctcgtcgcggaggcgcaggccggctacgaggcgggcgtccgctcggtgatcctgttcggg
atcccggagcacaaggacgagatcggcagcggcgcgtacgacgaggacggcatcgtcccg
caggcgatccgcgcgctgaaggcgcaggtcccgggcctcgtcgtgatgaccgacgtgtgc
atgtgcgagtacaccgaccacggccactgcggcatcctcaaggcgccgcgggccggcggt
cccggccaggacctcggggtcgacaacgacgcgaccctgccgctgctcgcgaaggaggcg
gtcgcgcacgccaaggccggcgcggacatcgtcgccccctccgacatgatggacggccgg
gtggccgcgatccggaaggggctcgacgccgaggggtacggggacgtgcccgtcctgtcg
tacgcggcgaagttcgcgggcgcgttctacggtccgttccgcgacgcggccgagagcgcg
ccgcgcgagggcgccggcatcccgaaggaccgcaagggctaccagatggatcccggcaac
tggcgggaggcgctgcgggaggtcgccctcgacgtggccgagggcgccgacatggtgatg
gtgaagcccgccgtcccgtacctcgacatcgtgcggctcgtccgcgatcggttcgagctc
ccggtggccgcgtaccacgtctccggtgagtacgcgatgatcaaggccgccgcggagcgg
ggctggatcgacgaggcgcgcgtcgtgctcgagacgctgctctgctgccgccgcgcgggc
gccgacctcgtcctcacctactacgcgaaggaggcggccggcctcctcacggggaagcgg
cggtga

DBGET integrated database retrieval system