KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_1732Help
Entry
Anae109_1732      CDS       T00559                                 

Definition
(GenBank) Diphosphate--fructose-6-phosphate 1-phosphotransferase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00010  Glycolysis / Gluconeogenesis
afw00030  Pentose phosphate pathway
afw00051  Fructose and mannose metabolism
afw00052  Galactose metabolism
afw00680  Methane metabolism
afw01100  Metabolic pathways
afw01110  Biosynthesis of secondary metabolites
afw01120  Microbial metabolism in diverse environments
afw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anae109_1732
   00030 Pentose phosphate pathway
    Anae109_1732
   00051 Fructose and mannose metabolism
    Anae109_1732
   00052 Galactose metabolism
    Anae109_1732
  Energy metabolism
   00680 Methane metabolism
    Anae109_1732
Enzymes [BR:afw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Anae109_1732
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Anae109_1732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ABS25935
JGI: Anae1091732
UniProt: A7HB39
Position
complement(1950297..1951481)
Genome map
AA seq 394 aa AA seqDB search
MARMRVGILTGGGDVPGLNSVIKSVVYRAADHDVEVLGIRRGWEGLTHLDLDDPASRGRY
VRALTRDNTRTIDRTGGTFLHSSRTNPARMKKLPPHLEGKSFPAAETTKKGITSTTFDVS
SAVLANLEALKIDYLLPIGGDDTLSYAARLHDLGAKVIAIPKTMDNDVRNTEYCIGFSTA
ITRAIGAIERQRTTVGSHERIGVFRIFGRDAGFTAFYTAYVTSIRCVIPEHKPKLEHLID
LLVTDKQQNPSSYALVVLSEGAEWEGYKVQEYGEPDAFGHRKKASVAESLSDAIKRVAGE
ETIVSDLTYDLRSGDPDFVDKLVANTFGTMAFDALLEGKSGLMSAIVDGKYDLVPIPDPK
LGPRKIDVASMYNTDRLRPIYANKRGLPVFLNRA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcacgaatgcgcgtcgggatcctcacgggcgggggcgacgtccccggcctcaactcc
gtcatcaagagcgtcgtctaccgggccgcggaccacgacgtggaggtcctcggcatccgg
cgcgggtgggaagggctcacccacctcgacctggacgatcccgcgagccgcggccggtac
gtgcgggcgctcacgcgcgacaacacccgcacgatcgaccgcacgggcggcaccttcctg
cactcgagccgcaccaacccggcgcgcatgaagaagctgccgccgcacctcgaggggaag
agcttcccggcggcggagaccacgaagaagggcatcacctccaccaccttcgacgtctcc
agcgcggtgctcgcgaacctggaggccctgaagatcgactacctcctccccatcggcggc
gacgacacgctctcctacgccgcgcggctgcacgacctcggggcgaaggtgatcgcgatc
ccgaagacgatggacaacgacgtccgcaacaccgagtactgcatcggcttctcgacggcg
atcacccgcgccatcggcgccatcgagcggcagcgcaccaccgtcggctcgcacgagcgc
atcggcgtcttccgcatcttcgggcgcgacgcggggttcaccgccttctacaccgcgtac
gtgacctccatccggtgcgtcatccccgagcacaagcccaagctcgagcacctcatcgat
ctgctggtgaccgacaagcagcagaacccctcgagctacgccctggtggtgctctccgag
ggcgcggagtgggagggctacaaggtccaggagtacggtgagccggacgcgttcgggcac
cgcaagaaggcgagcgtcgccgagtcgctctcggacgccatcaagcgggtcgccggcgag
gagacgatcgtctccgacctgacctacgacctgcgctccggcgatcccgacttcgtggac
aagctcgtcgcgaacaccttcggcacgatggcgttcgacgccctgctcgagggcaagagc
ggcctcatgtccgccatcgtcgacggcaagtacgacctcgtgccgatccccgatccgaag
ctcgggccccgcaagatcgacgtcgcgtcgatgtacaacaccgaccggctgcgcccgatc
tacgcgaacaagcgcggcctccccgtgttcctgaatcgcgcgtga

DBGET integrated database retrieval system