KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_1995Help
Entry
Anae109_1995      CDS       T00559                                 

Definition
dehydrogenase complex catalytic subunit
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Anae109_1995
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anae109_1995
   00020 Citrate cycle (TCA cycle)
    Anae109_1995
   00620 Pyruvate metabolism
    Anae109_1995
Enzymes [BR:afw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Anae109_1995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2259036..2260400
Genome map
AA seq 454 aa AA seqDB search
MAYKLELPDIGEGVVEAEVQQWFVKPGDDVAEDQPLVEVMTDKATVVIPSPKRGRVVKLF
FGVGDLAKVHSPLLELELEGAVAGAPEGPEGPRAKATVEAPSVASAPTPSGQRGAAPPEL
AEARPAGAGGEGPPRASGQKSLATPAVRALARELEIDINAVAGSGAGGRVTKDDLAAYRR
GTNGHGRPELRAAPAGELAPASRAPAAPPSPIPLRPESGGAADERVPLRGVRKRIAENMA
RSKRTAAHFTFVEQCDVTELARVKERMAVAAKEEGVKLTFLPFVVKAVVAALRKHPKLNA
TMDDERGELVLHRRYDVGIASATDAGLVVPVVRGADRRSLVELAREIERLAQDAKAGRAR
PEDMGRSTFTITSLGALGGMFATPVLNYPEVGILGVHRIRPTPVVRDGQVVVRDVMHVSV
TSDHRVVDGHEAAAFCYEVIRTLEDPNLLFMHLA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacaagctcgagctccccgacatcggcgagggcgtcgtcgaggccgaggtccag
cagtggttcgtgaagcccggcgacgacgtcgccgaggaccagccgctcgtcgaggtgatg
accgacaaggcgacggtcgtcatcccatcgccgaagcgcgggcgcgtcgtgaagctgttc
ttcggcgtgggcgacctggccaaggtgcactcgcccctcctcgagctggagctggagggg
gcggtcgcgggggcgccggaggggccggaggggccgcgcgcgaaggcgaccgtcgaggcg
ccctcggtggcgagcgcccccacgccgtcgggccagcgcggtgccgctcccccggagctt
gccgaggcgcggccggcgggcgccggcggggaggggcctccccgcgcctccggccagaag
tcgctcgcgacgccggcggtgcgcgcgctcgcgcgggagctcgagatcgacatcaacgcc
gtggcgggctcgggtgccggcgggcgcgtgacgaaggacgatctcgccgcgtaccggaga
ggcacgaacgggcacggacggccggagctgcgggccgcgccggcgggcgagctcgcgccc
gcctcccgcgcccccgcggcgccgccgtcgcccatcccgctccggccggagtcgggcggc
gcggccgacgagcgggtcccgctgcgtggcgtccgcaagcgcatcgccgagaacatggcc
cgctccaagcggaccgccgcgcacttcaccttcgtcgagcagtgcgacgtgacggagctc
gcgcgggtgaaggagcggatggcggtcgccgcgaaggaggagggggtgaagctcaccttc
ctcccgttcgtcgtgaaggccgtggtcgccgcgctccgcaagcacccgaagctgaacgcg
acgatggacgacgagcggggcgagctggtgctgcatcgccgctacgacgtcggcatcgcc
tccgccaccgacgcagggctggtcgtgccggtggtgcgcggcgcggaccggcgctcgctc
gtcgagctcgcccgcgagatcgagcggctcgcccaggacgcgaaggccggccgcgcgcgg
cccgaggacatgggccgctcgaccttcaccatcacgagcctcggcgcgctcggcgggatg
ttcgcgacgccggtgctcaactaccccgaggtcggcatcctcggggtgcaccggatccgg
cccacgccggtggtgcgcgacgggcaggtggtcgtgcgagacgtcatgcacgtgtccgtc
acgagcgaccaccgcgtcgtcgacgggcacgaggcggcggcgttctgctacgaggtcatc
cggacgctcgaggatccgaacctgctcttcatgcacctggcgtag

DBGET integrated database retrieval system