KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_2280Help
Entry
Anae109_2280      CDS       T00559                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00010  Glycolysis / Gluconeogenesis
afw00051  Fructose and mannose metabolism
afw00562  Inositol phosphate metabolism
afw01100  Metabolic pathways
afw01110  Biosynthesis of secondary metabolites
afw01120  Microbial metabolism in diverse environments
afw01130  Biosynthesis of antibiotics
afw01200  Carbon metabolism
afw01230  Biosynthesis of amino acids
Module
afw_M00002  Glycolysis, core module involving three-carbon compounds
afw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anae109_2280
   00051 Fructose and mannose metabolism
    Anae109_2280
   00562 Inositol phosphate metabolism
    Anae109_2280
Enzymes [BR:afw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Anae109_2280
Exosome [BR:afw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Anae109_2280
  Exosomal proteins of bladder cancer cells
   Anae109_2280
  Exosomal proteins of melanoma cells
   Anae109_2280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABS26482
JGI: Anae1092280
UniProt: A7HCN6
Position
complement(2585017..2585778)
Genome map
AA seq 253 aa AA seqDB search
MARQKFVCGNWKMHKTVAETAALVRELRSALGDAAGEVQVAVAPPFTALAAAVEAARGSA
IEIAAQDVHWEKQGAFTGEVSAPMLADVGCRHGIVGHSERRQLFGETDEAVRKKVGALLA
AGVRPIVCVGETLAEREAGRTLEVVDRQVRQGLAGLSVDELGRLTIAYEPVWAIGTGKTA
TSAQAQEVHAAIRRILRDVGAPVADQIRVQYGGSVKPENAAELMAQPDVDGALVGGASLK
AADFIAIVKGALR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggctcgccagaagttcgtctgcggaaactggaagatgcacaagaccgtcgccgagacg
gccgccctcgtccgcgagctgcggtcggccctcggcgacgcagccggcgaggtccaggtg
gcggtcgcgccgccgttcacggcgctcgccgccgccgtcgaggcggcgcgcggctccgcc
atcgagatcgcggcgcaggacgtccactgggagaagcagggggcgttcaccggcgaggtg
tccgcgcccatgctcgcggacgtggggtgccggcacggcatcgtgggccacagcgagcgg
cgccagctgttcggagagaccgacgaggcggtgcgcaagaaggtcggggcgctcctcgcg
gcgggcgtgaggccgatcgtctgcgtcggtgagacgctcgccgagcgcgaggcggggcgg
acgctggaggtggtcgaccgtcaggtccgccaggggctcgccgggctgtccgtcgacgag
ctcggccggctcaccatcgcctacgagccggtgtgggcgatcggcaccggcaagacggcc
acttcagcccaggcgcaggaggtccacgccgccatccggcgcatcctccgggacgtcggg
gctcccgtcgcggaccagatccgggtacagtacggcggctcggtcaagcccgagaacgcc
gcggagctgatggcgcagcccgatgtggacggggcgctggtcggcggcgcgagcctcaag
gcggcggacttcatcgccatcgtgaaaggtgcactccgttga

DBGET integrated database retrieval system