KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_2337Help
Entry
Anae109_2337      CDS       T00559                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Anae109_2337
Enzymes [BR:afw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Anae109_2337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2701383..2702225)
Genome map
AA seq 280 aa AA seqDB search
MRMRIGARLFDGPGPFIMGIVNATPDSFSDGGRYLDPAAAVAHALRLAEEGADLVDLGGE
STRPGAPPVAEDEEIRRVVPVVEALRARAFALPISIDTTKAAVARAALAAGADLVNDVAG
LADPALARVVAEAGAPVVLMHSRGTPADMQSRASYGDLVAEVRAELAEALLRVAAAGVAP
ERVILDPGIGFAKTAEHGFELLARLGELRALGRPLLVGPSRKSFIGKVTGAPVGERLPGT
LAAVTAAVLAGVELIRVHDVAAARQAAQVAAAIRDAPRTS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatgcggatcggggccaggctcttcgacgggcctggcccgttcatcatggggatc
gtcaacgcgaccccggactcgttctccgacggcgggcgctacctcgaccccgccgcggcg
gtggcccacgcgctccgtctcgccgaggaaggcgcggatctcgtcgacctcggcggcgag
tccacccggccaggcgcgccgccggtcgcggaggacgaggagatccggcgagtggtgccg
gtcgtggaggcgctgcgagcccgcgccttcgcgctgcccatctccatcgacacgaccaag
gccgcggtcgcgagggccgccctcgccgccggcgccgacctcgtgaacgacgtcgccggc
ctcgccgaccccgccctcgcccgcgtggtggcggaggcgggagctccggtcgtcctcatg
cactcgcgcggcaccccggcggacatgcagtcgcgcgcgagctacggagacctcgtcgcg
gaggttcgcgcggagctggccgaggcgctcctccgggtcgcggcggctggcgtcgcgccg
gagcgggtgatcctcgatccggggatcgggttcgcgaagaccgccgagcacggcttcgag
ctcctcgcccgcctgggcgagctgcgggcgctcgggaggcccctgctcgtgggcccgtcg
cgcaagagcttcatcggcaaggtcacgggtgcgccggtgggggagcggctccccggcacg
ctggcggccgtcacggccgccgtcctggcgggcgtcgagctgatccgcgtccacgacgtg
gcggccgcccgccaggcggctcaggtggcggcggccatccgggacgcgccgcggacgtcg
tga

DBGET integrated database retrieval system