KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_2445Help
Entry
Anae109_2445      CDS       T00559                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Anae109_2445
Enzymes [BR:afw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Anae109_2445
    3.5.1.-  
     Anae109_2445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2834386..2835039)
Genome map
AA seq 217 aa AA seqDB search
MSSMRIDREHDVLLAVDLQHDFLPGGALAVAGGDEIVAPIARLAPAFTTVVATQDWHPPG
HVSFASAHPGAKPFETIALSQGPQELWPDHCVQGTRGAALHPAFPDAAATLILRKGTRLD
VDSYSAFRENVGPDRRRPTTGLGAWLAARGARRVFVCGLARDFCVLWSAQDGAAEGFEVI
VLDDLTRAVFPDRRARVDDAFARAGVTLRGSSQLELG
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagctccatgcggatcgatcgcgagcacgacgtgctcctcgccgtggacctgcagcac
gacttcctgcccggcggcgcgctcgccgtcgcaggcggcgacgagatcgtggcgccgatc
gcccggctcgcgccggcgttcaccacggtcgtcgccacgcaggactggcatccgcccgga
cacgtctccttcgcgtccgcccaccccggcgcgaagccgttcgagaccatcgcgctgagc
caggggccgcaggagctctggccggaccactgcgtccagggcacgcgcggcgcggccctc
caccccgccttccccgacgccgccgcgacgctcatcctgcgcaagggcacgcgcctcgac
gtggactcctacagcgcctttcgtgagaacgtcgggccggaccggcgccgcccgaccacc
gggctcggggcctggctcgccgcgcgcggcgcgcggcgggtgttcgtgtgcggcctggcg
cgagacttctgcgtcctgtggtcggcccaggacggcgcggcggagggcttcgaggtgatc
gtgctcgacgacctcacgcgcgccgtcttcccggaccgccgggcgcgggtcgatgacgcc
ttcgcccgagcgggggtcacgctgcggggctcctcgcagctcgagctcgggtga

DBGET integrated database retrieval system